UniGene Name: sp_v3.0_unigene167952
Length: 233 nt
![]() |
---|
>sp_v3.0_unigene167952
C |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Probable alcohol dehydrogenase n=1 Tax=Bacteriovorax marinus SJ RepID=E1WYW6_BACMS | - | - | 1.0e-13 | 68% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 86% |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Alcohol dehydrogenase. | EC:1.1.1.1 | - | 3.659e-09 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Glycolysis / Gluconeogenesis | 00010 | 3.659e-09 | % | |
Sma3 | Fatty acid metabolism | 00071 | 3.659e-09 | % | |
Sma3 | Glycine, serine and threonine metabolism | 00260 | 3.659e-09 | % | |
Sma3 | Tyrosine metabolism | 00350 | 3.659e-09 | % | |
Sma3 | Chloroalkane and chloroalkene degradation | 00625 | 3.659e-09 | % | |
Sma3 | Naphthalene degradation | 00626 | 3.659e-09 | % | |
Sma3 | Retinol metabolism | 00830 | 3.659e-09 | % | |
Sma3 | Metabolism of xenobiotics by cytochrome P450 | 00980 | 3.659e-09 | % | |
Sma3 | Drug metabolism - cytochrome P450 | 00982 | 3.659e-09 | % | |
Sma3 | Metabolic pathways | 01100 | 3.659e-09 | % | |
Sma3 | Biosynthesis of secondary metabolites | 01110 | 3.659e-09 | % |
Source | Gene names |
---|---|
Sma3 | ADH2; ADH3; ADH6; ADH7; ADHIII; Adh2; AdhC6; At5g43940; FDH1; GSVIVT00014300001; GSVIVT00034834001; MRH10.4; PHYPADRAFT_137950; VITISV_030341; VITISV_039578; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | peroxisome | GO:0005777 | Cellular Component | 0.0 | - |
Sma3 | alcohol dehydrogenase (NAD) activity | GO:0004022 | Molecular Function | 0.0 | - |
Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
Sma3 | oxidoreductase activity | GO:0016491 | Molecular Function | 0.0 | - |
Sma3 | S-(hydroxymethyl)glutathione dehydrogenase activity | GO:0051903 | Molecular Function | 0.0 | - |
Sma3 | S-nitrosoglutathione reductase activity | GO:0080007 | Molecular Function | 0.0 | - |
Sma3 | ethanol oxidation | GO:0006069 | Biological Process | 0.0 | - |
Sma3 | heat acclimation | GO:0010286 | Biological Process | 0.0 | - |
Sma3 | formaldehyde metabolic process | GO:0046292 | Biological Process | 0.0 | - |
Sma3 | seed development | GO:0048316 | Biological Process | 0.0 | - |
Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Alcohol dehydrogenase superfamily, zinc-type | IPR002085 | - | 0.0 | - |
Sma3 | Alcohol dehydrogenase, zinc-type, conserved site | IPR002328 | - | 0.0 | - |
Sma3 | Alcohol dehydrogenase, C-terminal | IPR013149 | - | 0.0 | - |
Sma3 | Alcohol dehydrogenase GroES-like | IPR013154 | - | 0.0 | - |
Sma3 | Alcohol dehydrogenase class III/S-(hydroxymethyl)glutathione dehydrogenase | IPR014183 | - | 0.0 | - |
Sma3 | NAD(P)-binding domain | IPR016040 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT5G43940.2 | HOT5 GroES-like zinc-binding dehydrogenase family protein chr5:17684265-17686379 FORWARD LENGTH=391 | 1.0e-16 | 62% |
RefSeq | Arabidopsis thaliana | NP_199207.1 | alcohol dehydrogenase class-3 [Arabidopsis thaliana] | 1.0e-16 | 62% |
RefSeq | Populus trichocarpa | XP_002301836.1 | glutathione-dependent formaldehyde dehydrogenase [Populus trichocarpa] | 8.0e-16 | 60% |
![]() |
---|
Fln status: Putative C-terminus
Fln database: coniferopsida.fasta
Fln subject: B8LPA1
Fln msg: Unexpected stop codon in the beginning of your sequence, STOP codon was not found. Distance to subject end: 2 aas, your sequence is shorter than subject: 77 - 228
Fln protein:
R
Protein Length:
78
Fln nts:
C
Fln Alignment:
HIF1XHV03F97ZR___TAKQFGVTEYLNPTKFDKPIQEVIREMTEGGVDSSYECVGRVELMLAALQCS
B8LPA1________________TSKRFGVTEFLNPSDFDKPIQEVIREMTKGGVNSSYECVGRVELMLAALQCS
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain