SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene167916

Length: 324 nt

UniGene Fasta

>sp_v3.0_unigene167916
GTCAGGACAAGGCAGTTGCCACTTCAAAATGGCTTTACAAGATAAAGCACGCAGTTGATGGAAGTAAGGAAAAGTACAAGGCTCGTTTTGTTGCTCGTGGCTTCTCCCAGAAGGAAGGTATAGACTATGACGAGATATTTGCACCTGTTGCCACCATATGCTCAATCATAGCCCTTGCTACTTCGCAAGGATGGAACCTACATCAGATGGATGTCAAGACTGCGTTCTTACATGGTTCGATCAAAGAAGAGGTATATGTGGAGCAACCTGAAGGATTTGAGATTTATGATTGAGAATCTCATGTGTGTAGGTTGAAGAAGGCCC

Ace file of the UniGene sp_v3.0_unigene167916

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	Putaive copia-like retrotransposon polyprotein, 5'-partial (Fragment) n=2 Tax=Oryza sativa RepID=Q8W5D1_ORYSA	-	-	3.0e-27	53%
FL-Next	tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	0.0	49%
Sma3	Retrotransposon protein, putative, Ty1-copia subclass	-	-	7.34e-35	-

Source	Gene names
Sma3	AT4g22040; At2g05390; At2g05960; At2g15650; At2g16670; At2g23330; B1003C08.12; B1065G12.28; B1110B01.4; F11I4_21; F28G4.2; F28H19.6; F28K20.17; H0512B01.8; LOC_Os03g06540; LOC_Os03g20080; LOC_Os03g24620; LOC_Os03g30860; LOC_Os03g47702; LOC_Os03g59190; LOC

Source	GOs	Term	Type	Identity
Sma3	chromatin	GO:0000785	Cellular Component	-
Sma3	nucleus	GO:0005634	Cellular Component	-
Sma3	mitochondrion	GO:0005739	Cellular Component	-
Sma3	endoplasmic reticulum membrane	GO:0005789	Cellular Component	-
Sma3	integral to membrane	GO:0016021	Cellular Component	-
Sma3	nucleic acid binding	GO:0003676	Molecular Function	-
Sma3	DNA binding	GO:0003677	Molecular Function	-
Sma3	chromatin binding	GO:0003682	Molecular Function	-
Sma3	catalytic activity	GO:0003824	Molecular Function	-
Sma3	RNA-directed DNA polymerase activity	GO:0003964	Molecular Function	-
Sma3	monooxygenase activity	GO:0004497	Molecular Function	-
Sma3	peroxidase activity	GO:0004601	Molecular Function	-
Sma3	iron ion binding	GO:0005506	Molecular Function	-
Sma3	ATP binding	GO:0005524	Molecular Function	-
Sma3	zinc ion binding	GO:0008270	Molecular Function	-
Sma3	electron carrier activity	GO:0009055	Molecular Function	-
Sma3	ATPase activity	GO:0016887	Molecular Function	-
Sma3	nucleoside-triphosphatase activity	GO:0017111	Molecular Function	-
Sma3	heme binding	GO:0020037	Molecular Function	-
Sma3	iron-sulfur cluster binding	GO:0051536	Molecular Function	-
Sma3	chromatin assembly or disassembly	GO:0006333	Biological Process	-
Sma3	GPI anchor biosynthetic process	GO:0006506	Biological Process	-
Sma3	apoptotic process	GO:0006915	Biological Process	-
Sma3	defense response	GO:0006952	Biological Process	-
Sma3	response to oxidative stress	GO:0006979	Biological Process	-
Sma3	DNA integration	GO:0015074	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	Peptidase S8/S53, subtilisin/kexin/sedolisin	IPR000209	-	-
Sma3	BTB/POZ-like	IPR000210	-	-
Sma3	Peptidase M14, carboxypeptidase A	IPR000834	-	-
Sma3	Chromo domain/shadow	IPR000953	-	-
Sma3	Cytochrome P450	IPR001128	-	-
Sma3	Aminoacyl-tRNA synthetase, class I, conserved site	IPR001412	-	-
Sma3	Tetratricopeptide TPR-1	IPR001440	-	-
Sma3	4Fe-4S binding domain	IPR001450	-	-
Sma3	Integrase, catalytic core	IPR001584	-	-
Sma3	Pleckstrin homology domain	IPR001849	-	-
Sma3	Zinc finger, CCHC-type	IPR001878	-	-
Sma3	Haem peroxidase, plant/fungal/bacterial	IPR002016	-	-
Sma3	DNA methylase, N-6 adenine-specific, conserved site	IPR002052	-	-
Sma3	Ankyrin repeat	IPR002110	-	-
Sma3	Phosphotransferase system, HPr serine phosphorylation site	IPR002114	-	-
Sma3	NB-ARC	IPR002182	-	-
Sma3	Chaperonin TCP-1, conserved site	IPR002194	-	-
Sma3	Cytochrome P450, E-class, group I	IPR002401	-	-
Sma3	HhH-GPD domain	IPR003265	-	-
Sma3	ABC transporter-like	IPR003439	-	-
Sma3	AAA+ ATPase domain	IPR003593	-	-
Sma3	Retrotransposon gag protein	IPR005162	-	-
Sma3	Uncharacterised protein family Cys-rich	IPR006461	-	-
Sma3	RNase L inhibitor RLI, possible metal-binding domain	IPR007209	-	-
Sma3	GPI biosynthesis protein Pig-F	IPR009580	-	-
Sma3	DNA helicase PIF1, ATP-dependent	IPR010285	-	-
Sma3	BTB/POZ fold	IPR011333	-	-
Sma3	Tetratricopeptide-like helical	IPR011990	-	-
Sma3	Tetratricopeptide repeat-containing domain	IPR013026	-	-
Sma3	BTB/POZ	IPR013069	-	-
Sma3		IPR013084	-	-
Sma3	Reverse transcriptase, RNA-dependent DNA polymerase	IPR013103	-	-
Sma3	ABC transporter, ABCE	IPR013283	-	-
Sma3	Domain of unknown function DUF1785	IPR014811	-	-
Sma3	ABC transporter, conserved site	IPR017871	-	-
Sma3	4Fe-4S ferredoxin-type, iron-sulpur binding domain	IPR017896	-	-
Sma3	4Fe-4S ferredoxin, iron-sulphur binding, conserved site	IPR017900	-	-
Sma3	Cytochrome P450, conserved site	IPR017972	-	-
Sma3		IPR017973	-	-
Sma3	Asp/Glu racemase, active site	IPR018187	-	-
Sma3	Heat shock protein DnaJ, conserved site	IPR018253	-	-
Sma3	Tetratricopeptide repeat	IPR019734	-	-
Sma3	WD40 repeat, conserved site	IPR019775	-	-

Full-Lengther Next Prediction

Fln status: Internal

Fln database: coniferopsida.fasta

Fln subject: B8LKV8

Fln msg: Unexpected STOP codon at 3' end. Distance to subject end: 233 aas, your sequence is shorter than subject: 97 - 363

Fln protein: QDKAVATSKWLYKIKHAVDGSKEKYKARFVARGFSQKEGIDYDEIFAPVATICSIIALATSQGWNLHQMDVKTAFLHGSIKEEVYVEQPEGFEIYD*

Protein Length: 98

Fln nts: GTCAGGACAAGGCAGTTGCCACTTCAAAATGGCTTTACAAGATAAAGCACGCAGTTGATGGAAGTAAGGAAAAGTACAAGGCTCGTTTTGTTGCTCGTGGCTTCTCCCAGAAGGAAGGTATAGACTATGACGAGATATTTGCACCTGTTGCCACCATATGCTCAATCATAGCCCTTGCTACTTCGCAAGGATGGAACCTACATCAGATGGATGTCAAGACTGCGTTCTTACATGGTTCGATCAAAGAAGAGGTATATGTGGAGCAACCTGAAGGATTTGAGATTTATGATTGAGAATCTCATGTGTGTAGGTTGAAGAAGGCCC

Fln Alignment:

HIF1XHV03HJHD0___QDKAVATSKWLYKIKHAVDGSKEKYKARFVARGFSQKEGIDYDEIFAPVA---TICSIIALATSQGWNLHQMDVKTAFLHGSIKEEVYVEQPEGFEIYD*ESHVCRLKKA
B8LKV8________________KEKECISVKWVYKTKYKANGELDKHKARLVAKGFAQEYGVDYNETFAPVARLDTIRMVLAIAAQHNWKVYQMDVKSAFLNGYLEEEVYVQQPPRYEVRGQEDKVYRLKKA

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain