UniGene Name: sp_v3.0_unigene167913
Length: 190 nt
UniGene Fasta
|
|---|
| >sp_v3.0_unigene167913
T |
Ace file of the UniGene sp_v3.0_unigene167913
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Xylem serine proteinase 1, putative n=1 Tax=Ricinus communis RepID=B9SGA4_RICCO | - | - | 2.0e-13 | 73% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 71% |
| Sma3 | Xylem serine proteinase 1, putative | - | - | 0.0 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | 2-alkenal reductase. | EC:1.3.1.74 | - | 3.22e-15 | - |
| Sma3 | Cucumisin. | EC:3.4.21.25 | - | 3.36312e-44 | - |
| Source | Gene names |
|---|---|
| Sma3 | 46C02.13; ARA12; ASP48; AT4g26330; AT4g34980; At1g01900; At2g05920; At3g14240; At4g26330; At4g34980; At5g03620; At5g45650; At5g45650/MRA19_5; At5g51750; At5g59810/mmn10_30; At5g67360; F17C15_40; F22M8.3; GSVIVT00001051001; GSVIVT00001054001; GSVIVT0000105 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | cell wall | GO:0005618 | Cellular Component | 0.0 | - |
| Sma3 | plant-type cell wall | GO:0009505 | Cellular Component | 0.0 | - |
| Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
| Sma3 | extracellular matrix | GO:0031012 | Cellular Component | 0.0 | - |
| Sma3 | apoplast | GO:0048046 | Cellular Component | 0.0 | - |
| Sma3 | serine-type endopeptidase activity | GO:0004252 | Molecular Function | 0.0 | - |
| Sma3 | calcium ion binding | GO:0005509 | Molecular Function | 0.0 | - |
| Sma3 | identical protein binding | GO:0042802 | Molecular Function | 0.0 | - |
| Sma3 | proteolysis | GO:0006508 | Biological Process | 0.0 | - |
| Sma3 | double fertilization forming a zygote and endosperm | GO:0009567 | Biological Process | 0.0 | - |
| Sma3 | plant-type cell wall modification | GO:0009827 | Biological Process | 0.0 | - |
| Sma3 | negative regulation of catalytic activity | GO:0043086 | Biological Process | 0.0 | - |
| Sma3 | response to cadmium ion | GO:0046686 | Biological Process | 0.0 | - |
| Sma3 | mucilage metabolic process involved seed coat development | GO:0048359 | Biological Process | 0.0 | - |
| Sma3 | mucilage extrusion from seed coat | GO:0080001 | Biological Process | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT3G14240.1 | Subtilase family protein chr3:4741637-4743964 REVERSE LENGTH=775 | 8.0e-17 | 73% |
| RefSeq | Arabidopsis thaliana | NP_566483.1 | Subtilase family protein [Arabidopsis thaliana] | 1.0e-16 | 73% |
| RefSeq | Populus trichocarpa | XP_002330593.1 | predicted protein [Populus trichocarpa] | 5.0e-18 | 71% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: D5AE86
Fln msg: Distance to subject end: 193 aas, your sequence is shorter than subject: 62 - 394
Fln protein:
G
Protein Length:
63
Fln nts:
T
Fln Alignment:
HIF1XHV03FT2O8___DNRYVPFNLDSGTSMACPHIAGVAALLKSAHPDWSSAAIRSAIMT
D5AE86________________DRRRTQFNILSGTSMACPHVSGVAALLKGAHPQWSPAAVRSALMT

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta