UniGene Name: sp_v3.0_unigene167790
Length: 168 nt
![]() |
---|
>sp_v3.0_unigene167790
C |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | putative DNA mismatch repair protein [Arabidopsis thaliana] | - | - | 8.0e-09 | 64% |
FL-Next | sp=DNA mismatch repair protein Msh3; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 64% |
Source | Gene names |
---|---|
Sma3 | AT4g25540; At4g25540; H0124B04.17; M7J2.90; MSH3; OSJNBa0032F06.21; OsI_17969; OsI_17972; OsJ_16670; PHYPADRAFT_178460; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | damaged DNA binding | GO:0003684 | Molecular Function | 0.0 | - |
Sma3 | catalytic activity | GO:0003824 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | solute:hydrogen antiporter activity | GO:0015299 | Molecular Function | 0.0 | - |
Sma3 | mismatched DNA binding | GO:0030983 | Molecular Function | 0.0 | - |
Sma3 | mismatch repair | GO:0006298 | Biological Process | 0.0 | - |
Sma3 | potassium ion transport | GO:0006813 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | DNA mismatch repair protein MutS, C-terminal | IPR000432 | - | 0.0 | - |
Sma3 | Regulator of K+ conductance, N-terminal | IPR003148 | - | 0.0 | - |
Sma3 | K+/H+ exchanger | IPR004771 | - | 0.0 | - |
Sma3 | Cation/H+ exchanger | IPR006153 | - | 0.0 | - |
Sma3 | DNA mismatch repair protein MutS-like, N-terminal | IPR007695 | - | 0.0 | - |
Sma3 | DNA mismatch repair protein MutS, core | IPR007696 | - | 0.0 | - |
Sma3 | DNA mismatch repair protein MutS, connector | IPR007860 | - | 0.0 | - |
Sma3 | DNA mismatch repair protein MutS, clamp | IPR007861 | - | 0.0 | - |
Sma3 | NAD(P)-binding domain | IPR016040 | - | 0.0 | - |
Sma3 | DNA mismatch repair protein MutS, N-terminal | IPR016151 | - | 0.0 | - |
Sma3 | Chromogranin, conserved site | IPR018054 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT4G25540.1 | MSH3, ATMSH3 homolog of DNA mismatch repair protein MSH3 chr4:13042700-13048115 REVERSE LENGTH=1081 | 1.0e-12 | 64% |
RefSeq | Arabidopsis thaliana | NP_194284.2 | DNA mismatch repair protein Msh3 [Arabidopsis thaliana] | 1.0e-12 | 64% |
RefSeq | Populus trichocarpa | XP_002322465.1 | predicted protein [Populus trichocarpa] | 2.0e-11 | 52% |
![]() |
---|
Fln status: Internal
Fln database: sp_plants
Fln subject: O65607
Fln msg: Distance to subject end: 60 aas, your sequence is shorter than subject: 56 - 1081
Fln protein:
Q
Protein Length:
57
Fln nts:
C
Fln Alignment:
HIF1XHV03HA92U___ITFLYKLVAGVASRSFGLHVARLAQLPDSCIMQAAIMAAKFEKEVCAR
O65607________________VTYLYKLVRGLCSRSFGFKVAQLAQIPPSCIRRAISMAAKLEAEVRAR
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain