UniGene Name: sp_v3.0_unigene167728
Length: 194 nt
UniGene Fasta |
---|
>sp_v3.0_unigene167728
T |
Ace file of the UniGene sp_v3.0_unigene167728 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | histone-lysine N-methyltransferase ATX3 [Arabidopsis thaliana] sp|Q9M364.2|ATX3_ARATH RecName: Full=Histone-lysine N-methyltransferase ATX3; AltName: Full=Protein SET DOMAIN GROUP 14; AltName: Full=Trithorax-homolog protein 3; Short=TRX-homolog protein 3 | - | - | 6.0e-12 | 78% |
FL-Next | sp=Histone-lysine N-methyltransferase ATX3; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 78% |
Sma3 | Trithorax, putative | - | - | 1.443e-08 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Histone-lysine N-methyltransferase. | EC:2.1.1.43 | - | 2.329e-13 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Lysine degradation | 00310 | 2.329e-13 | % |
Source | Gene names |
---|---|
Sma3 | ATX3; ATX4; ATX5; At3g61740; At4g27910; At5g53430; F15G16.130; GSVIVT00027049001; GSVIVT00037113001; MYN8.4; Os01g0218800; OsI_00917; OsI_03117; OsJ_00897; OsJ_02868; P0489G09.14; PHYPADRAFT_145070; POPTRDRAFT_250990; POPTRDRAFT_421736; POPTRDRAFT_755391; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | methyltransferase activity | GO:0008168 | Molecular Function | 0.0 | - |
Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
Sma3 | histone-lysine N-methyltransferase activity | GO:0018024 | Molecular Function | 0.0 | - |
Sma3 | DNA mediated transformation | GO:0009294 | Biological Process | 0.0 | - |
Sma3 | chromatin modification | GO:0016568 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | PWWP | IPR000313 | - | 0.0 | - |
Sma3 | SET domain | IPR001214 | - | 0.0 | - |
Sma3 | Zinc finger, PHD-type | IPR001965 | - | 0.0 | - |
Sma3 | ABC transporter-like | IPR003439 | - | 0.0 | - |
Sma3 | AAA+ ATPase domain | IPR003593 | - | 0.0 | - |
Sma3 | Post-SET domain | IPR003616 | - | 0.0 | - |
Sma3 | ABC transporter, N-terminal | IPR010509 | - | 0.0 | - |
Sma3 | ABC transporter, conserved site | IPR017871 | - | 0.0 | - |
Sma3 | ABC transporter, integral membrane type 1 | IPR017940 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT3G61740.1 | SDG14, ATX3 SET domain protein 14 chr3:22851133-22856548 REVERSE LENGTH=1018 | 4.0e-16 | 78% |
RefSeq | Arabidopsis thaliana | NP_001078326.1 | histone-lysine N-methyltransferase ATX3 [Arabidopsis thaliana] | 5.0e-16 | 78% |
RefSeq | Populus trichocarpa | XP_002302628.1 | SET domain protein [Populus trichocarpa] | 3.0e-17 | 79% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q9M364
Fln msg: Distance to subject end: 66 aas, your sequence is shorter than subject: 64 - 1018
Fln protein:
L
Protein Length:
65
Fln nts:
T
Fln Alignment:
HIF1XHV03GQ12E___LFARRHIREGEMVLEYRGEQVRRSVADLREIHYRSQGKDCYL
Q9M364________________LFARKSIQEGEMIIEYRGVKVRRSVADLREANYRSQGKDCYL
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain