SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene167682

Length: 210 nt

UniGene Fasta

>sp_v3.0_unigene167682
GTTCGAGGTTGTGAGAGATGCATTTTTGAAGAGTCGAGAAGTAGCTCCTGGACTCATAAGAATGCATTTCCATGATTGTTTCGTCAGGGGATGCGATGGGTCTGTTCTGATAGACTCCACTGCCAACAGCACTGCAGAGAAATATAGCCCTATTAACAATCCGAGCCTTCACTGATTTGACGTGATTGACACAGCGAAGTCGAGATTAGA

Ace file of the UniGene sp_v3.0_unigene167682

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	Peroxidase prx12 n=1 Tax=Spinacia oleracea RepID=Q9M4Z5_SPIOL	-	-	9.0e-21	70%
FL-Next	tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	0.0	50%
Sma3	Putative peroxidase	-	-	1.876e-27	-

Source	ECs	Term	Type	e value	Identity
Sma3	Peroxidase.	EC:1.11.1.7	-	8.802e-40	-

Source	KEGGs	Term	e value	Identity
Sma3	Phenylalanine metabolism	00360	8.802e-40	%
Sma3	Methane metabolism	00680	8.802e-40	%
Sma3	Phenylpropanoid biosynthesis	00940	8.802e-40	%
Sma3	Biosynthesis of phenylpropanoids	01061	8.802e-40	%
Sma3	Metabolic pathways	01100	8.802e-40	%
Sma3	Biosynthesis of secondary metabolites	01110	8.802e-40	%

Source	Gene names
Sma3	At5g42180; B1135C02.43; B1135C02.47; GSVIVT00011734001; GSVIVT00022533001; GSVIVT00022535001; GSVIVT00022537001; GSVIVT00023610001; GSVIVT00026051001; GSVIVT00028183001; GSVIVT00037159001; LOC_Os03g02920; LOC_Os03g25280; LOC_Os03g25300; LOC_Os03g25320; LO

Source	GOs	Term	Type	Identity
Sma3	extracellular region	GO:0005576	Cellular Component	-
Sma3	nucleus	GO:0005634	Cellular Component	-
Sma3	plant-type cell wall	GO:0009505	Cellular Component	-
Sma3	integral to membrane	GO:0016021	Cellular Component	-
Sma3	DNA binding	GO:0003677	Molecular Function	-
Sma3	peroxidase activity	GO:0004601	Molecular Function	-
Sma3	iron ion binding	GO:0005506	Molecular Function	-
Sma3	calcium ion binding	GO:0005509	Molecular Function	-
Sma3	electron carrier activity	GO:0009055	Molecular Function	-
Sma3	heme binding	GO:0020037	Molecular Function	-
Sma3	response to oxidative stress	GO:0006979	Biological Process	-
Sma3	hydrogen peroxide catabolic process	GO:0042744	Biological Process	-
Sma3		GO:0045449	Biological Process	-
Sma3	oxidation-reduction process	GO:0055114	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	Plant peroxidase	IPR000823	-	-
Sma3	SANT/Myb domain	IPR001005	-	-
Sma3	Haem peroxidase, plant/fungal/bacterial	IPR002016	-	-
Sma3	Auxin responsive SAUR protein	IPR003676	-	-
Sma3		IPR012287	-	-
Sma3		IPR014778	-	-
Sma3	Myb transcription factor	IPR015495	-	-
Sma3	Myb-like domain	IPR017877	-	-
Sma3	Myb domain, DNA-binding	IPR017930	-	-
Sma3	Peroxidases heam-ligand binding site	IPR019793	-	-
Sma3	Peroxidase, active site	IPR019794	-	-

Source	Species	ID	Description	e value	Identity
ATG	Arabidoptis thaliana	AT5G42180.1	Peroxidase superfamily protein chr5:16852702-16854021 FORWARD LENGTH=317	1.0e-16	57%
RefSeq	Arabidopsis thaliana	NP_199033.1	peroxidase 64 [Arabidopsis thaliana]	2.0e-16	57%
RefSeq	Populus trichocarpa	XP_002321949.1	predicted protein [Populus trichocarpa]	3.0e-26	71%

Full-Lengther Next Prediction

Fln status: Internal

Fln database: coniferopsida.fasta

Fln subject: B8LR59

Fln msg: Unexpected STOP codon at 3' end. Distance to subject end: 206 aas, your sequence is shorter than subject: 58 - 327

Fln protein: FEVVRDAFLKSREVAPGLIRMHFHDCFVRGCDGSVLIDSTANSTAEKYSPINNPSLH*

Protein Length: 59

Fln nts: GTTCGAGGTTGTGAGAGATGCATTTTTGAAGAGTCGAGAAGTAGCTCCTGGACTCATAAGAATGCATTTCCATGATTGTTTCGTCAGGGGATGCGATGGGTCTGTTCTGATAGACTCCACTGCCAACAGCACTGCAGAGAAATATAGCCCTATTAACAATCCGAGCCTTCACTGATTTGACGTGATTGACACAGCGAAGTCGAGATTAGA

Fln Alignment:

HIF1XHV01B6V8W___VVRDAFLKSREVAPGLIRMHFHDCFVRGCDGSVLIDSTANSTAEKYSPINNPSLH*FDVIDTAKSRL
B8LR59________________VVMQAVAKEKRMGASLLRLHFHDCFVNGCDGSILLDDTSTFTGEKTANPNNNSVRGFDVIDTIKTQV

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain