|
||||||
|
UniGene Name: sp_v3.0_unigene167649
Length: 124 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene167649
C |
|
Ace file of the UniGene sp_v3.0_unigene167649
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | 6-phosphogluconate dehydrogenase-like protein [Arabidopsis thaliana] ref|NP_850352.1| 6-phosphogluconate dehydrogenase-like protein [Arabidopsis thaliana] ref|NP_001031525.1| 6-phosphogluconate dehydrogenase-like protein [Arabidopsis thaliana] gb|AAB84336 | - | - | 9.0e-11 | 84% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 86% |
| Sma3 | Glycerol-3-phosphate dehydrogenase | - | - | 1.432e-14 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Glycerol-3-phosphate dehydrogenase (NAD(P)(+)). | EC:1.1.1.94 | - | 2.505e-08 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Glycerophospholipid metabolism | 00564 | 2.505e-08 | % |
| Source | Gene names |
|---|---|
| Sma3 | AT2G41540; At2g41540; At3g07690; B1150F11.17; F17A17.3; GSVIVT00025647001; GSVIVT00028665001; MLP3.14; OJ1579_G03.13; Os01g0801600; Os01g0939600; Os05g0495700; OsI_04100; OsI_05133; OsI_20460; OsJ_03778; OsJ_04716; OsJ_19053; P0003D09.23; POPTRDRAFT_57623 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | cytosol | GO:0005829 | Cellular Component | 0.0 | - |
| Sma3 | glycerol-3-phosphate dehydrogenase complex | GO:0009331 | Cellular Component | 0.0 | - |
| Sma3 | glycerol-3-phosphate dehydrogenase [NAD+] activity | GO:0004367 | Molecular Function | 0.0 | - |
| Sma3 | oxidoreductase activity, acting on CH-OH group of donors | GO:0016614 | Molecular Function | 0.0 | - |
| Sma3 | NAD binding | GO:0051287 | Molecular Function | 0.0 | - |
| Sma3 | carbohydrate metabolic process | GO:0005975 | Biological Process | 0.0 | - |
| Sma3 | glycerol-3-phosphate catabolic process | GO:0046168 | Biological Process | 0.0 | - |
| Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Glycerol-3-phosphate dehydrogenase, NAD-dependent, C-terminal | IPR006109 | - | 0.0 | - |
| Sma3 | Glycerol-3-phosphate dehydrogenase, NAD-dependent | IPR006168 | - | 0.0 | - |
| Sma3 | Glycerol-3-phosphate dehydrogenase, NAD-dependent, N-terminal | IPR011128 | - | 0.0 | - |
| Sma3 | Dehydrogenase, multihelical | IPR013328 | - | 0.0 | - |
| Sma3 | NAD(P)-binding domain | IPR016040 | - | 0.0 | - |
| Sma3 | Peroxidases heam-ligand binding site | IPR019793 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT2G41540.1 | GPDHC1 6-phosphogluconate dehydrogenase family protein chr2:17326801-17328654 FORWARD LENGTH=462 | 2.0e-15 | 84% |
| RefSeq | Arabidopsis thaliana | NP_181685.1 | 6-phosphogluconate dehydrogenase-like protein [Arabidopsis thaliana] | 2.0e-15 | 84% |
| RefSeq | Populus trichocarpa | XP_002308924.1 | predicted protein [Populus trichocarpa] | 2.0e-15 | 84% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: D5AAK9
Fln msg: Unexpected stop codon in the beginning of your sequence, Distance to subject end: 119 aas, your sequence is shorter than subject: 41 - 393
Fln protein:
*
Protein Length:
42
Fln nts:
C
Fln Alignment:
HIF1XHV01BK7Z2___SLFCPYCTSEMIFITHLIAEEPEKLAGPLLADTYVTLL
D5AAK9________________SVYFAHCTSEMIFITHLIAEEPEKLAGPLLADTYVTLL
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
