|
||||||
|
UniGene Name: sp_v3.0_unigene167625
Length: 182 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene167625
A |
|
Ace file of the UniGene sp_v3.0_unigene167625
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | TPA: class III peroxidase 32 precursor [Oryza sativa Japonica Group] gb|EAY88151.1| hypothetical protein OsI_09586 [Oryza sativa Indica Group] | - | - | 3.0e-16 | 73% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 91% |
| Sma3 | Peroxidase | - | - | 3.478e-35 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Peroxidase. | EC:1.11.1.7 | - | 0.0 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Phenylalanine metabolism | 00360 | 0.0 | % | |
| Sma3 | Methane metabolism | 00680 | 0.0 | % | |
| Sma3 | Phenylpropanoid biosynthesis | 00940 | 0.0 | % | |
| Sma3 | Biosynthesis of phenylpropanoids | 01061 | 0.0 | % | |
| Sma3 | Metabolic pathways | 01100 | 0.0 | % | |
| Sma3 | Biosynthesis of secondary metabolites | 01110 | 0.0 | % |
| Source | Gene names |
|---|---|
| Sma3 | At1g05240; At1g05250; At1g05260; At1g77100; At2g41480; At3g01190; At3g21770; At5g05340; At5g15180; At5g19890; At5g39580; At5g42180; At5g64120; B1135C02.43; B1135C02.47; F22K20.17; F28I16.40; F8M21_70; FBP4; GSVIVT00002117001; GSVIVT00006924001; GSVIVT0000 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | extracellular region | GO:0005576 | Cellular Component | 0.0 | - |
| Sma3 | cell wall | GO:0005618 | Cellular Component | 0.0 | - |
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
| Sma3 | plant-type cell wall | GO:0009505 | Cellular Component | 0.0 | - |
| Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
| Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
| Sma3 | apoplast | GO:0048046 | Cellular Component | 0.0 | - |
| Sma3 | peroxidase activity | GO:0004601 | Molecular Function | 0.0 | - |
| Sma3 | iron ion binding | GO:0005506 | Molecular Function | 0.0 | - |
| Sma3 | calcium ion binding | GO:0005509 | Molecular Function | 0.0 | - |
| Sma3 | electron carrier activity | GO:0009055 | Molecular Function | 0.0 | - |
| Sma3 | heme binding | GO:0020037 | Molecular Function | 0.0 | - |
| Sma3 | response to oxidative stress | GO:0006979 | Biological Process | 0.0 | - |
| Sma3 | response to desiccation | GO:0009269 | Biological Process | 0.0 | - |
| Sma3 | response to cold | GO:0009409 | Biological Process | 0.0 | - |
| Sma3 | hyperosmotic salinity response | GO:0042538 | Biological Process | 0.0 | - |
| Sma3 | hydrogen peroxide catabolic process | GO:0042744 | Biological Process | 0.0 | - |
| Sma3 | respiratory burst | GO:0045730 | Biological Process | 0.0 | - |
| Sma3 | rhythmic process | GO:0048511 | Biological Process | 0.0 | - |
| Sma3 | defense response to fungus | GO:0050832 | Biological Process | 0.0 | - |
| Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Major intrinsic protein | IPR000425 | - | 0.0 | - |
| Sma3 | Plant peroxidase | IPR000823 | - | 0.0 | - |
| Sma3 | Haem peroxidase, plant/fungal/bacterial | IPR002016 | - | 0.0 | - |
| Sma3 | TonB box, conserved site | IPR010916 | - | 0.0 | - |
| Sma3 | Haem oxygenase-like, multi-helical | IPR016084 | - | 0.0 | - |
| Sma3 | Peroxidases heam-ligand binding site | IPR019793 | - | 0.0 | - |
| Sma3 | Peroxidase, active site | IPR019794 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT1G05250.1 | Peroxidase superfamily protein chr1:1525924-1527169 REVERSE LENGTH=325 | 1.0e-21 | 60% |
| RefSeq | Arabidopsis thaliana | NP_563732.1 | peroxidase 1/2 [Arabidopsis thaliana] | 2.0e-21 | 60% |
| RefSeq | Populus trichocarpa | XP_002338764.1 | predicted protein, partial [Populus trichocarpa] | 5.0e-27 | 77% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9P1P4
Fln msg: Distance to subject end: 163 aas, your sequence is shorter than subject: 60 - 324
Fln protein:
F
Protein Length:
61
Fln nts:
A
Fln Alignment:
HIF1XHV01BI4R1___FQVIDAAKAAMEKVCPGVVSCADILALVVRDAVHMLGGPFWNVPTGRRDGLVSIANEAL
A9P1P4________________FQVIDAAKAAVEKVCPGVVSCADILALVARDAVHMLGGPFWNVPTGRRDGVVSIQNEAV
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
