SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene167532

Length: 227 nt

UniGene Fasta

>sp_v3.0_unigene167532
GCCTCGTGTTGTTGTGCAAACAACAAGTGATGTGGACATTCTGGATGATGGTTATCGATGGCGTAAATATGGACAGAAAGTGGTCAAGGGGAATCCTCATCCTAGGAGTTATTACAAATGCACCAATGTGGGCTGCAGTGTACGTAAGCATGTTGAGAGGGCATCAAATGATATCAAAGCTGTCATTACAACCTATGAAGGAAACGCACAACCATGATGTTCCAGCA

Ace file of the UniGene sp_v3.0_unigene167532

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	WRKY transcription factor PmWRKY117 (Fragment) n=1 Tax=Pinus monticola RepID=E6Y3E9_PINMO	-	-	2.0e-33	100%
FL-Next	tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	0.0	89%
Sma3	WRKY transcription factor, putative	-	-	8.999e-17	-

Source	Gene names
Sma3	At1g13960; At1g55600; At1g69310; At2g03340; At2g04880; At2g30250; At2g38470; At2g44745; At3g01080; At4g26440; At4g26640; At4g30935; At5g07100; At5g49520; At5g56270; C90ERIPDM; DcLasD; F16A14.18; F1O13.1; F20N2.3; F28I8.34; F6I18.4; F7A19.5; GSVIVT00003337

Source	GOs	Term	Type	Identity
Sma3	nucleus	GO:0005634	Cellular Component	-
Sma3	outer membrane-bounded periplasmic space	GO:0030288	Cellular Component	-
Sma3	sequence-specific DNA binding transcription factor activity	GO:0003700	Molecular Function	-
Sma3	transporter activity	GO:0005215	Molecular Function	-
Sma3	protein binding	GO:0005515	Molecular Function	-
Sma3	zinc ion binding	GO:0008270	Molecular Function	-
Sma3	transcription activator activity	GO:0016563	Molecular Function	-
Sma3	sequence-specific DNA binding	GO:0043565	Molecular Function	-
Sma3	regulation of transcription, DNA-dependent	GO:0006355	Biological Process	-
Sma3	response to cold	GO:0009409	Biological Process	-
Sma3	response to salt stress	GO:0009651	Biological Process	-
Sma3	salicylic acid mediated signaling pathway	GO:0009863	Biological Process	-
Sma3	response to chitin	GO:0010200	Biological Process	-
Sma3	cytochrome complex assembly	GO:0017004	Biological Process	-
Sma3	regulation of defense response	GO:0031347	Biological Process	-
Sma3		GO:0045449	Biological Process	-
Sma3		GO:0045941	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	ATPase, F1/V1/A1 complex, alpha/beta subunit, nucleotide-binding domain	IPR000194	-	-
Sma3	Peptidase S8/S53, subtilisin/kexin/sedolisin	IPR000209	-	-
Sma3	Peptidase aspartic, active site	IPR001969	-	-
Sma3	DNA-binding WRKY	IPR003657	-	-
Sma3	ABC transporter, haem export, CcmA	IPR005895	-	-
Sma3	Pre-mRNA polyadenylation factor Fip1	IPR007854	-	-
Sma3	Aldehyde dehydrogenase, conserved site	IPR016160	-	-
Sma3	Glycoside hydrolase, family 1, active site	IPR018120	-	-
Sma3	Chaperonin Cpn60, conserved site	IPR018370	-	-

Source	Species	ID	Description	e value	Identity
ATG	Arabidoptis thaliana	AT2G38470.1	WRKY33, ATWRKY33 WRKY DNA-binding protein 33 chr2:16108476-16110539 FORWARD LENGTH=519	8.0e-38	86%
RefSeq	Arabidopsis thaliana	NP_181381.2	putative WRKY transcription factor 33 [Arabidopsis thaliana]	1.0e-37	86%
RefSeq	Populus trichocarpa	XP_002323637.1	predicted protein [Populus trichocarpa]	6.0e-38	88%

Full-Lengther Next Prediction

Fln status: Internal

Fln database: coniferopsida.fasta

Fln subject: D5ABY6

Fln msg: Unexpected STOP codon at 3' end. Distance to subject end: 199 aas, your sequence is shorter than subject: 72 - 411

Fln protein: PRVVVQTTSDVDILDDGYRWRKYGQKVVKGNPHPRSYYKCTNVGCSVRKHVERASNDIKAVITTYEGNAQP*

Protein Length: 73

Fln nts: GCCTCGTGTTGTTGTGCAAACAACAAGTGATGTGGACATTCTGGATGATGGTTATCGATGGCGTAAATATGGACAGAAAGTGGTCAAGGGGAATCCTCATCCTAGGAGTTATTACAAATGCACCAATGTGGGCTGCAGTGTACGTAAGCATGTTGAGAGGGCATCAAATGATATCAAAGCTGTCATTACAACCTATGAAGGAAACGCACAACCATGATGTTCCAGCA

Fln Alignment:

HIF1XHV01AN1W8___PRVVVQTTSDVDILDDGYRWRKYGQKVVKGNPHPRSYYKCTNVGCSVRKHVERASNDIKAVITTYEG
D5ABY6________________PRVVVQTTSEIDILDDGYRWRKYGQKVVKGNPNPRSYYKCTNAGCPVRKHVERASHDPKAVITTYEG

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain