UniGene Name: sp_v3.0_unigene167529
Length: 248 nt
![]() |
---|
>sp_v3.0_unigene167529
G |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Endo-beta-1,4-glucanase n=1 Tax=Pinus radiata RepID=O64401_PINRA | - | - | 2.0e-29 | 79% |
FL-Next | tr=Endo-beta-1,4-glucanase; Pinus radiata (Monterey pine) (Pinus insignis). | - | - | 0.0 | 79% |
Sma3 | Endo-1,4-beta-glucanase | - | - | 9.106e-20 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Cellulase. | EC:3.2.1.4 | - | 0.0 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Starch and sucrose metabolism | 00500 | 0.0 | % |
Source | Gene names |
---|---|
Sma3 | At1g02800; At1g22880; At4g02290; B1011A07.26; CEL1; CEL2; CEL5; CcCel2; Cel1; Cel4; Cel5; Cel7; Cel9; EGL1; EGL2; F19G10.16; F22D16.21; GLU12; GLU14; GLU8; GSVIVT00000510001; GSVIVT00028035001; LOC_Os01g21070; LOC_Os02g03120; LOC_Os09g36060; OJ1531_B07.26 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | extracellular region | GO:0005576 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | plant-type cell wall | GO:0009505 | Cellular Component | 0.0 | - |
Sma3 | hydrolase activity, hydrolyzing O-glycosyl compounds | GO:0004553 | Molecular Function | 0.0 | - |
Sma3 | cellulase activity | GO:0008810 | Molecular Function | 0.0 | - |
Sma3 | carbohydrate metabolic process | GO:0005975 | Biological Process | 0.0 | - |
Sma3 | cellular cell wall organization | GO:0007047 | Biological Process | 0.0 | - |
Sma3 | pattern specification process | GO:0007389 | Biological Process | 0.0 | - |
Sma3 | response to nematode | GO:0009624 | Biological Process | 0.0 | - |
Sma3 | fruit ripening | GO:0009835 | Biological Process | 0.0 | - |
Sma3 | cellulose catabolic process | GO:0030245 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Glycoside hydrolase, family 9 | IPR001701 | - | 0.0 | - |
Sma3 | Six-hairpin glycosidase | IPR012341 | - | 0.0 | - |
Sma3 | Glycoside hydrolase, family 9, active site | IPR018221 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT4G02290.1 | AtGH9B13, GH9B13 glycosyl hydrolase 9B13 chr4:1002654-1005125 REVERSE LENGTH=516 | 1.0e-32 | 67% |
RefSeq | Arabidopsis thaliana | NP_192138.1 | endoglucanase 17 [Arabidopsis thaliana] | 2.0e-32 | 67% |
RefSeq | Populus trichocarpa | XP_002301487.1 | glycosyl hydrolase family 9 [Populus trichocarpa] | 1.0e-34 | 69% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: O64401
Fln msg: Distance to subject end: 109 aas, your sequence is shorter than subject: 82 - 510
Fln protein:
E
Protein Length:
83
Fln nts:
G
Fln Alignment:
HIF1XHV01BXN6U___EYKGHADNYICYLLPGTPSSHAKYTPGGLLYTLQDTNLQYVTSSSFLLLTYAKYLSSSKQVVSCGGTMTVTPHRLRTLAKRQ
O64401________________DYKGHADNYICSLLPGVSYSQAKYTPGGLLYTLSDSNLQYVTSSSFLLFTYAKYLSSSKHVVTC-GSMTFSPKRLRTIAKRQ
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain