UniGene Name: sp_v3.0_unigene167456
Length: 134 nt
![]() |
---|
>sp_v3.0_unigene167456
A |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Uridine kinase n=3 Tax=rosids RepID=B9N5N9_POPTR | - | - | 2.0e-13 | 94% |
FL-Next | sp=Uridine kinase-like protein 5; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 92% |
Sma3 | Uridine kinase | - | - | 0.0 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Uracil phosphoribosyltransferase. | EC:2.4.2.9 | - | 4.415e-13 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Pyrimidine metabolism | 00240 | 4.415e-13 | % | |
Sma3 | Metabolic pathways | 01100 | 4.415e-13 | % | |
Sma3 | Uridine kinase. | EC:2.7.1.48 | - | 0.0 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Pyrimidine metabolism | 00240 | 0.0 | % | |
Sma3 | Drug metabolism - other enzymes | 00983 | 0.0 | % | |
Sma3 | Metabolic pathways | 01100 | 0.0 | % |
Source | Gene names |
---|---|
Sma3 | AT1G55810; At1g55810; At3g27190; At3g27440; At4g26510; At5g40870; GSVIVT00003320001; GSVIVT00017920001; GSVIVT00020531001; GSVIVT00020636001; LOC_Os11g16370; OJ1770_H02.29; OJ1789_C07.8; OSTLU_47740; Os02g0273000; Os08g0530000; Os09g0505800; Os11g0265000; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
Sma3 | uracil phosphoribosyltransferase activity | GO:0004845 | Molecular Function | 0.0 | - |
Sma3 | uridine kinase activity | GO:0004849 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | kinase activity | GO:0016301 | Molecular Function | 0.0 | - |
Sma3 | transferase activity, transferring glycosyl groups | GO:0016757 | Molecular Function | 0.0 | - |
Sma3 | phosphotransferase activity, alcohol group as acceptor | GO:0016773 | Molecular Function | 0.0 | - |
Sma3 | metabolic process | GO:0008152 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Uridine kinase | IPR000764 | - | 0.0 | - |
Sma3 | Phosphoribulokinase/uridine kinase | IPR006083 | - | 0.0 | - |
Sma3 | Protein of unknown function DUF1296 | IPR009719 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT3G27440.1 | UKL5 uridine kinase-like 5 chr3:10155555-10157931 FORWARD LENGTH=465 | 1.0e-18 | 92% |
RefSeq | Arabidopsis thaliana | NP_189380.1 | putative uracil phosphoribosyltransferase [Arabidopsis thaliana] | 1.0e-18 | 92% |
RefSeq | Populus trichocarpa | XP_002299055.1 | predicted protein [Populus trichocarpa] | 8.0e-19 | 94% |
![]() |
---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q9LTY6
Fln msg: Distance to subject end: 151 aas, your sequence is shorter than subject: 44 - 465
Fln protein:
S
Protein Length:
45
Fln nts:
A
Fln Alignment:
HIF1XHV01A198V___SDRLIRLVVENGLGHLPFTEKQVTTPTGSVYTGVDFCK
Q9LTY6________________ADRLIRLVVEHGLGHLPFTEKQITTPTGSVYTGVDFCK
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain