UniGene Name: sp_v3.0_unigene167452
Length: 242 nt
UniGene Fasta
|
|---|
| >sp_v3.0_unigene167452
A |
Ace file of the UniGene sp_v3.0_unigene167452
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | cyclic nucleotide and calmodulin-regulated ion channel-like protein [Arabidopsis thaliana] | - | - | 3.0e-30 | 73% |
| FL-Next | sp=Probable cyclic nucleotide-gated ion channel 17; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 73% |
| Sma3 | Cyclic nucleotide-gated ion channel, putative | - | - | 3.565e-26 | - |
| Source | Gene names |
|---|---|
| Sma3 | ACBK1; AT5G57940; At1g01340; At1g15990; At1g19780; At2g23980; At2g24610; At2g28260; At2g46430; At3g48010; At4g01010; At4g30360; At4g30560; At5g14870; At5g53130; At5g57940; CBP4; CBP7; CBT1; CNGC-A; CNGC-C; CNGC1; CNGC10; CNGC13; CNGC14; CNGC15; CNGC16; CN |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
| Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
| Sma3 | apical plasma membrane | GO:0016324 | Cellular Component | 0.0 | - |
| Sma3 | ion channel activity | GO:0005216 | Molecular Function | 0.0 | - |
| Sma3 | intracellular cyclic nucleotide activated cation channel activity | GO:0005221 | Molecular Function | 0.0 | - |
| Sma3 | voltage-gated potassium channel activity | GO:0005249 | Molecular Function | 0.0 | - |
| Sma3 | calmodulin binding | GO:0005516 | Molecular Function | 0.0 | - |
| Sma3 | cAMP binding | GO:0030552 | Molecular Function | 0.0 | - |
| Sma3 | cGMP binding | GO:0030553 | Molecular Function | 0.0 | - |
| Sma3 | ion transport | GO:0006811 | Biological Process | 0.0 | - |
| Sma3 | potassium ion transport | GO:0006813 | Biological Process | 0.0 | - |
| Sma3 | calcium ion transport | GO:0006816 | Biological Process | 0.0 | - |
| Sma3 | cellular calcium ion homeostasis | GO:0006874 | Biological Process | 0.0 | - |
| Sma3 | pollen tube growth | GO:0009860 | Biological Process | 0.0 | - |
| Sma3 | response to cadmium ion | GO:0046686 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | IQ motif, EF-hand binding site | IPR000048 | - | 0.0 | - |
| Sma3 | Cyclic nucleotide-binding domain | IPR000595 | - | 0.0 | - |
| Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
| Sma3 | Potassium channel, voltage-dependent, EAG/ELK/ERG | IPR003938 | - | 0.0 | - |
| Sma3 | Ion transport | IPR005821 | - | 0.0 | - |
| Sma3 | RmlC-like jelly roll fold | IPR014710 | - | 0.0 | - |
| Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
| Sma3 | IPR017442 | - | 0.0 | - | |
| Sma3 | Cyclic nucleotide-binding, conserved site | IPR018488 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT4G30360.1 | ATCNGC17, CNGC17 cyclic nucleotide-gated channel 17 chr4:14855060-14857779 REVERSE LENGTH=720 | 2.0e-37 | 73% |
| RefSeq | Arabidopsis thaliana | NP_194765.2 | cyclic nucleotide gated channel [Arabidopsis thaliana] | 2.0e-37 | 73% |
| RefSeq | Populus trichocarpa | XP_002314283.1 | predicted protein [Populus trichocarpa] | 2.0e-36 | 72% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q8L7Z0
Fln msg: Distance to subject end: 240 aas, your sequence is shorter than subject: 80 - 720
Fln protein:
T
Protein Length:
81
Fln nts:
A
Fln Alignment:
HIF1XHV01BNQQX___TYLQSITIKLEQWRIKQMDTEEWMQHRQLPPELSERIRRYNQYKWVATRGVDEKSLLENLPMDLCRDIKRHLCLDLVRRV
Q8L7Z0________________TYLQSLTVRLEEWRLKKRDTEEWMRHRQLPEELRNRVRRYEQYKWLATRGVDEEVLLQSLPTDLRRDIQRHLCLDLVRRV

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta