|
||||||
|
UniGene Name: sp_v3.0_unigene167444
Length: 228 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene167444
C |
|
Ace file of the UniGene sp_v3.0_unigene167444
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | putative MATE efflux family protein [Oryza sativa Japonica Group] | - | - | 1.0e-19 | 68% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 88% |
| Sma3 | Transparent testa 12 protein | - | - | 6.039e-10 | - |
| Source | Gene names |
|---|---|
| Sma3 | At1g11670; At3g21690; GSVIVT00010745001; GSVIVT00010746001; GSVIVT00010747001; GSVIVT00026024001; GSVIVT00026026001; GSVIVT00026028001; GSVIVT00026029001; LOC_Os03g37411; LOC_Os03g37490; LOC_Os03g37640; NtMATE1; NtMATE2; OSJNBa0036M16.106; OSJNBa0095N06.1 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
| Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
| Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
| Sma3 | RNA-directed DNA polymerase activity | GO:0003964 | Molecular Function | 0.0 | - |
| Sma3 | aspartic-type endopeptidase activity | GO:0004190 | Molecular Function | 0.0 | - |
| Sma3 | drug transmembrane transporter activity | GO:0015238 | Molecular Function | 0.0 | - |
| Sma3 | antiporter activity | GO:0015297 | Molecular Function | 0.0 | - |
| Sma3 | RNA-dependent DNA replication | GO:0006278 | Biological Process | 0.0 | - |
| Sma3 | proteolysis | GO:0006508 | Biological Process | 0.0 | - |
| Sma3 | drug transmembrane transport | GO:0006855 | Biological Process | 0.0 | - |
| Sma3 | DNA integration | GO:0015074 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Reverse transcriptase | IPR000477 | - | 0.0 | - |
| Sma3 | Integrase, catalytic core | IPR001584 | - | 0.0 | - |
| Sma3 | Multi antimicrobial extrusion protein | IPR002528 | - | 0.0 | - |
| Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT3G21690.1 | MATE efflux family protein chr3:7638750-7641861 FORWARD LENGTH=506 | 5.0e-25 | 92% |
| RefSeq | Arabidopsis thaliana | NP_188806.1 | mate efflux domain-containing protein [Arabidopsis thaliana] | 6.0e-25 | 92% |
| RefSeq | Populus trichocarpa | XP_002321125.1 | predicted protein [Populus trichocarpa] | 1.0e-24 | 76% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NV31
Fln msg: Distance to subject end: 406 aas, your sequence is shorter than subject: 75 - 513
Fln protein:
D
Protein Length:
76
Fln nts:
C
Fln Alignment:
HIF1XHV01CCU37___DNQPWIKMMKDAVXXXXXXXXXXXXPAVVVYMVNYIMSMSTQIFCGHLGNLELAAASLGNTGIQVFAYGLMLGMG
A9NV31________________DDQPWIKMMRDAVFLESKLLCRLALPAVIVYMVNYIMSMATQIFSGHLGNLELAAASLGNRGIQVFAYGLMLGMG
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
