UniGene Name: sp_v3.0_unigene167394
Length: 239 nt
UniGene Fasta |
---|
>sp_v3.0_unigene167394
A |
Ace file of the UniGene sp_v3.0_unigene167394 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | [Q] COG2124 Cytochrome P450 | - | - | 1.0e-07 | 37% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 87% |
Sma3 | Flavonoid 3'-hydroxylase | - | - | 1.072e-19 | - |
Source | Gene names |
---|---|
Sma3 | At1g66540; At1g74550; At5g06900; CYP71AP2v1; CYP736A3v2; CYP736A5v1; CYP76X3; CYP93A1; CYP93E1; CYP93E3; CYP98A10; CYP98A11; F1M20.23; F28G11.4; F3'H; F3'H1; F3'H2; F3'H3; Fuchsia; GSVIVT00005727001; GSVIVT00007388001; GSVIVT00007389001; GSVIVT00008626001 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
Sma3 | monooxygenase activity | GO:0004497 | Molecular Function | 0.0 | - |
Sma3 | iron ion binding | GO:0005506 | Molecular Function | 0.0 | - |
Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
Sma3 | electron carrier activity | GO:0009055 | Molecular Function | 0.0 | - |
Sma3 | heme binding | GO:0020037 | Molecular Function | 0.0 | - |
Sma3 | GO:0050381 | Molecular Function | 0.0 | - | |
Sma3 | DNA integration | GO:0015074 | Biological Process | 0.0 | - |
Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Protease inhibitor I4, serpin | IPR000215 | - | 0.0 | - |
Sma3 | Cytochrome P450 | IPR001128 | - | 0.0 | - |
Sma3 | Aminoacyl-tRNA synthetase, class I, conserved site | IPR001412 | - | 0.0 | - |
Sma3 | Integrase, catalytic core | IPR001584 | - | 0.0 | - |
Sma3 | Zinc finger, CCHC-type | IPR001878 | - | 0.0 | - |
Sma3 | Cytochrome P450, E-class, group I | IPR002401 | - | 0.0 | - |
Sma3 | Reverse transcriptase, RNA-dependent DNA polymerase | IPR013103 | - | 0.0 | - |
Sma3 | Cytochrome P450, conserved site | IPR017972 | - | 0.0 | - |
Sma3 | IPR017973 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G66540.1 | Cytochrome P450 superfamily protein chr1:24824837-24826502 FORWARD LENGTH=386 | 3.0e-24 | 53% |
RefSeq | Arabidopsis thaliana | NP_001117558.1 | putative cytochrome P450 [Arabidopsis thaliana] | 3.0e-24 | 53% |
RefSeq | Populus trichocarpa | XP_002334744.1 | cytochrome P450, partial [Populus trichocarpa] | 2.0e-24 | 60% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LNX9
Fln msg: Distance to subject end: 130 aas, your sequence is shorter than subject: 79 - 462
Fln protein:
T
Protein Length:
80
Fln nts:
A
Fln Alignment:
HIF1XHV01BO8LJ___TAPIPIEWAMSEALRNPPVMKKLQDELESVVGLGRMVCESDLPRLVYLQAVVKETLRLHPAGPLLYRRLSAESCDVLGY
B8LNX9________________TAPTAIEWAMSEALRNPPVMKKLQDELERVVGLGRMVCESDLPRLVYLQAVVKETLRLYPSGPFLTRHLSAASCNVLGY
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain