UniGene Name: sp_v3.0_unigene167308
Length: 180 nt
UniGene Fasta |
---|
>sp_v3.0_unigene167308
G |
Ace file of the UniGene sp_v3.0_unigene167308 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Alpha-galactosidase n=1 Tax=Phaseolus vulgaris RepID=Q41100_PHAVU | - | - | 2.0e-14 | 65% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 67% |
Sma3 | Alpha-galactosidase | - | - | 7.77e-28 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Alpha-galactosidase. | EC:3.2.1.22 | - | 1.87e-29 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Galactose metabolism | 00052 | 1.87e-29 | % | |
Sma3 | Glycerolipid metabolism | 00561 | 1.87e-29 | % | |
Sma3 | Sphingolipid metabolism | 00600 | 1.87e-29 | % | |
Sma3 | Glycosphingolipid biosynthesis - globo series | 00603 | 1.87e-29 | % |
Source | Gene names |
---|---|
Sma3 | At5g08370; F8L15_100; GLA; GSVIVT00002618001; GSVIVT00002619001; GSVIVT00029420001; LOC_Os10g35070; OSJNBa0051D19.18; OsI_34149; OsJ_32004; POPTRDRAFT_228333; POPTRDRAFT_566552; POPTRDRAFT_786149; RCOM_0612700; RCOM_1454590; VITISV_000962; VITISV_043596; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | plant-type cell wall | GO:0009505 | Cellular Component | 0.0 | - |
Sma3 | hydrolase activity, hydrolyzing O-glycosyl compounds | GO:0004553 | Molecular Function | 0.0 | - |
Sma3 | alpha-galactosidase activity | GO:0004557 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | cation binding | GO:0043169 | Molecular Function | 0.0 | - |
Sma3 | carbohydrate metabolic process | GO:0005975 | Biological Process | 0.0 | - |
Sma3 | positive regulation of flower development | GO:0009911 | Biological Process | 0.0 | - |
Sma3 | leaf morphogenesis | GO:0009965 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Glycoside hydrolase, clan GH-D | IPR000111 | - | 0.0 | - |
Sma3 | WW/Rsp5/WWP | IPR001202 | - | 0.0 | - |
Sma3 | Glycoside hydrolase, family 27 | IPR002241 | - | 0.0 | - |
Sma3 | Glycosyl hydrolase, family 13, all-beta | IPR013780 | - | 0.0 | - |
Sma3 | Aldolase-type TIM barrel | IPR013785 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT5G08370.1 | AtAGAL2, AGAL2 alpha-galactosidase 2 chr5:2691116-2693441 REVERSE LENGTH=396 | 1.0e-16 | 58% |
RefSeq | Arabidopsis thaliana | NP_001031855.1 | alpha-galactosidase 2 [Arabidopsis thaliana] | 1.0e-16 | 58% |
RefSeq | Populus trichocarpa | XP_002331416.1 | predicted protein [Populus trichocarpa] | 6.0e-19 | 63% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LQ47
Fln msg: Distance to subject end: 45 aas, your sequence is shorter than subject: 60 - 133
Fln protein:
G
Protein Length:
61
Fln nts:
G
Fln Alignment:
HIF1XHV01AVFEJ___KLGSSWRTTQDIEDKWESIVSHADQ*--ICKLCSSGGWNDPDMLEVGNGKMTTEEYASH
B8LQ47________________QIGSSWRTTDDIEDKWESMISRADQNNEFAQYAGPGGWNDPDMLEVGNGNMTPEEYGSH
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain