|
||||||
|
UniGene Name: sp_v3.0_unigene167202
Length: 115 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene167202
C |
|
Ace file of the UniGene sp_v3.0_unigene167202
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Phosphate transporter (Fragment) n=1 Tax=Oryza sativa RepID=Q9M5K0_ORYSA | - | - | 3.0e-14 | 100% |
| FL-Next | tr=Putative phosphate transporter; Cryptomeria japonica (Japanese cedar) (Cupressus japonica). | - | - | 0.0 | 100% |
| Sma3 | H(+)/Pi cotransporter | - | - | 0.0 | - |
| Source | Gene names |
|---|---|
| Sma3 | 5K14.7; APT1; APT2; At1g20860; At1g76430; At2g32830; At2g38940; At3g54700; At5g43340; At5g43350; At5g43360; At5g43370; EcPT1; EcPT2; EdPT1; F14G6.3; F15M4.7; F24L7.3; F9H16.16; GSVIVT00002927001; GSVIVT00006480001; GSVIVT00006481001; GSVIVT00020254001; GS |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | vacuole | GO:0005773 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | plastid | GO:0009536 | Cellular Component | 0.0 | - |
| Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
| Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
| Sma3 | transporter activity | GO:0005215 | Molecular Function | 0.0 | - |
| Sma3 | inorganic phosphate transmembrane transporter activity | GO:0005315 | Molecular Function | 0.0 | - |
| Sma3 | symporter activity | GO:0015293 | Molecular Function | 0.0 | - |
| Sma3 | transport | GO:0006810 | Biological Process | 0.0 | - |
| Sma3 | phosphate ion transport | GO:0006817 | Biological Process | 0.0 | - |
| Sma3 | cellular response to phosphate starvation | GO:0016036 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Peptidase, cysteine peptidase active site | IPR000169 | - | 0.0 | - |
| Sma3 | WW/Rsp5/WWP | IPR001202 | - | 0.0 | - |
| Sma3 | Carbohydrate/puine kinase, PfkB, conserved site | IPR002173 | - | 0.0 | - |
| Sma3 | Hydroxymethylglutaryl-CoA reductase, class I/II | IPR002202 | - | 0.0 | - |
| Sma3 | Phosphate permease | IPR004738 | - | 0.0 | - |
| Sma3 | General substrate transporter | IPR005828 | - | 0.0 | - |
| Sma3 | Sugar transporter, conserved site | IPR005829 | - | 0.0 | - |
| Sma3 | Serine/threonine-specific protein phosphatase/bis(5-nucleosyl)-tetraphosphatase | IPR006186 | - | 0.0 | - |
| Sma3 | Major facilitator superfamily | IPR011701 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT5G43360.1 | " PHT3, ATPT4, PHT1;3 phosphate transporter 1;3 chr5:17409524-17411214 FORWARD LENGTH=521" | 2.0e-19 | 97% |
| RefSeq | Arabidopsis thaliana | NP_199150.1 | putative inorganic phosphate transporter 1-3 [Arabidopsis thaliana] | 3.0e-19 | 97% |
| RefSeq | Populus trichocarpa | XP_002339222.1 | high affinity inorganic phosphate transporter [Populus trichocarpa] | 3.0e-20 | 97% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: Q1XG57
Fln msg: Distance to subject end: 372 aas, your sequence is shorter than subject: 38 - 544
Fln protein:
W
Protein Length:
39
Fln nts:
C
Fln Alignment:
HIF1XHV01CIA96___WLGFGIGGDYPLSATIMSEYANKRTRGAFIAAVFAMQG
Q1XG57________________WLGFGIGGDYPLSATIMSEYANKRTRGAFIAAVFAMQG
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
