|
||||||
|
UniGene Name: sp_v3.0_unigene167194
Length: 223 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene167194
C |
|
Ace file of the UniGene sp_v3.0_unigene167194
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Chalcone synthase (Fragment) n=1 Tax=Picea abies RepID=Q8RVR1_PICAB | - | - | 4.0e-21 | 94% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 98% |
| Sma3 | Chalcone synthase | - | - | 0.0 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Transferases, Acyltransferases, Transferring groups other than amino-acyl groups. | EC:2.3.1.- | - | 5.742e-06 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Acridone alkaloid biosynthesis | 01058 | 6.062e-07 | % | |
| Sma3 | Biosynthesis of alkaloids derived from shikimate pathway | 01063 | 6.062e-07 | % | |
| Sma3 | Biosynthesis of secondary metabolites | 01110 | 6.062e-07 | % | |
| Sma3 | Naringenin-chalcone synthase. | EC:2.3.1.74 | - | 0.0 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Flavonoid biosynthesis | 00941 | 0.0 | % | |
| Sma3 | Biosynthesis of phenylpropanoids | 01061 | 0.0 | % | |
| Sma3 | Metabolic pathways | 01100 | 0.0 | % | |
| Sma3 | Biosynthesis of secondary metabolites | 01110 | 0.0 | % |
| Source | Gene names |
|---|---|
| Sma3 | ACS2; ACS3; ACS4; AT5G13930.1; At5g13930; BIBSY212; C2; CHS; CHS-C; CHS-D; CHS-LF3; CHS-P; CHS1; CHS2; CHS3; CHS4; CHS4-2; CHS5; CHS6; CHS6-4; CHS9; CHSA1; CHSB1; CHSD; CHSI; CHSII; CSF7; EgCHS-A; EgCHS-B; GlCHS-B; GlCHS-C; ICHS1; LhCHSA; LhCHSB; OsI_0351 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
| Sma3 | GO:0008415 | Molecular Function | 0.0 | - | |
| Sma3 | naringenin-chalcone synthase activity | GO:0016210 | Molecular Function | 0.0 | - |
| Sma3 | acridone synthase activity | GO:0050635 | Molecular Function | 0.0 | - |
| Sma3 | response to stress | GO:0006950 | Biological Process | 0.0 | - |
| Sma3 | biosynthetic process | GO:0009058 | Biological Process | 0.0 | - |
| Sma3 | flavonoid biosynthetic process | GO:0009813 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Chalcone/stilbene synthase, N-terminal | IPR001099 | - | 0.0 | - |
| Sma3 | Polyketide synthase, type III | IPR011141 | - | 0.0 | - |
| Sma3 | Chalcone/stilbene synthase, C-terminal | IPR012328 | - | 0.0 | - |
| Sma3 | Thiolase-like, subgroup | IPR016038 | - | 0.0 | - |
| Sma3 | Chalcone/stilbene synthase, active site | IPR018088 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT5G13930.1 | CHS, TT4, ATCHS Chalcone and stilbene synthase family protein chr5:4488762-4490035 FORWARD LENGTH=395 | 4.0e-18 | 77% |
| RefSeq | Arabidopsis thaliana | NP_196897.1 | chalcone synthase [Arabidopsis thaliana] | 5.0e-18 | 77% |
| RefSeq | Populus trichocarpa | XP_002321081.1 | chalcone synthase [Populus trichocarpa] | 9.0e-18 | 79% |
| Full-Lengther Next Prediction |
|---|
Fln status: C-terminus
Fln database: coniferopsida.fasta
Fln subject: A9P2L2
Fln msg: your sequence is shorter than subject: 52 - 396
Fln protein:
C
Protein Length:
53
Fln nts:
C
Fln Alignment:
HIF1XHV01BGEK3___CVHFILDEMRKSSRQNGCSTTGEGLDVGVLFGFGPGLTVETVVLRSVPCSD
A9P2L2________________CVHFILDEMRKSSRQNGCSTTGEGLDVGVLFGFGPGLTVETVVLRSVPCTD
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
