UniGene Name: sp_v3.0_unigene167178
Length: 112 nt
UniGene Fasta |
---|
>sp_v3.0_unigene167178
C |
Ace file of the UniGene sp_v3.0_unigene167178 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Nucleoside diphosphate kinase B NdkB (Fragment) n=1 Tax=Heliobacillus mobilis RepID=Q9ZGE0_HELMO | - | - | 2.0e-10 | 83% |
FL-Next | sp=Nucleoside diphosphate kinase; Pinus pinaster (Maritime pine). | - | - | 0.0 | 72% |
Sma3 | Nucleoside diphosphate kinase | - | - | 0.0 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Nucleoside-diphosphate kinase. | EC:2.7.4.6 | - | 0.0 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Purine metabolism | 00230 | 0.0 | % | |
Sma3 | Pyrimidine metabolism | 00240 | 0.0 | % | |
Sma3 | Metabolic pathways | 01100 | 0.0 | % | |
Sma3 | Biosynthesis of secondary metabolites | 01110 | 0.0 | % |
Source | Gene names |
---|---|
Sma3 | AT4G11010; At4g11010; At4g23900; Bc-NDPK3; BcNDK III; F25I24.220; F8M12.12; GSVIVT00006748001; GSVIVT00010474001; LOC_Os10g41410; NDK1; NDK2; NDK3; NDK4; NDKN1; NDKP1; NDKR; NDPK; NDPK 1; NDPK1; NDPK2; NDPK3; NDPK3a; NDPK3b; NDPKIII; OSJNBa0027P10.4; OSJN |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | mitochondrial inner membrane | GO:0005743 | Cellular Component | 0.0 | - |
Sma3 | mitochondrial intermembrane space | GO:0005758 | Cellular Component | 0.0 | - |
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | thylakoid | GO:0009579 | Cellular Component | 0.0 | - |
Sma3 | magnesium ion binding | GO:0000287 | Molecular Function | 0.0 | - |
Sma3 | nucleoside diphosphate kinase activity | GO:0004550 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | GTP biosynthetic process | GO:0006183 | Biological Process | 0.0 | - |
Sma3 | UTP biosynthetic process | GO:0006228 | Biological Process | 0.0 | - |
Sma3 | CTP biosynthetic process | GO:0006241 | Biological Process | 0.0 | - |
Sma3 | response to oxidative stress | GO:0006979 | Biological Process | 0.0 | - |
Sma3 | red, far-red light phototransduction | GO:0009585 | Biological Process | 0.0 | - |
Sma3 | red or far-red light signaling pathway | GO:0010017 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Nucleoside diphosphate kinase | IPR001564 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT4G23900.1 | Nucleoside diphosphate kinase family protein chr4:12424505-12426318 FORWARD LENGTH=237 | 2.0e-13 | 75% |
RefSeq | Arabidopsis thaliana | NP_567690.1 | nucleoside diphosphate kinase IV [Arabidopsis thaliana] | 2.0e-13 | 75% |
RefSeq | Populus trichocarpa | XP_002299472.1 | predicted protein [Populus trichocarpa] | 8.0e-14 | 78% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: Q8RVI6
Fln msg: Distance to subject end: 112 aas, your sequence is shorter than subject: 37 - 235
Fln protein:
E
Protein Length:
38
Fln nts:
C
Fln Alignment:
HLKU4M003F2NJ0___ERTFIALKPDAVQRGLIGEIITRFEKKGFKLVAMKFL
Q8RVI6________________ERTFIAIKPDGVQRGLISEIVSRFERKGYKLVAIKLV
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain