|
||||||
|
UniGene Name: sp_v3.0_unigene167116
Length: 104 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene167116
T |
|
Ace file of the UniGene sp_v3.0_unigene167116
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | leucine-rich repeat protein kinase-like protein [Arabidopsis thaliana] dbj|BAC42504.1| unknown protein [Arabidopsis thaliana] gb|ACN59279.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis thaliana] gb|AEE36273.1| leucine-rich repeat protein | - | - | 2.0e-09 | 90% |
| FL-Next | tr=Uncharacterized protein; Cryptomeria japonica (Japanese cedar) (Cupressus japonica). | - | - | 0.0 | 72% |
| Sma3 | Receptor protein kinase-like | - | - | 7.45e-10 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Mitogen-activated protein kinase kinase kinase. | EC:2.7.11.25 | - | 4.653e-10 | - |
| Source | Gene names |
|---|---|
| Sma3 | AT1G79620; AT5G49760; AT5G49770; At1g21230; At1g79620; At1g79620/F20B17_5; At5g15730; At5g49760; At5g49760/K2I5_13; At5g49780; At5g54380; B1148D12.10; F14F8_110; F16F4.9; GSVIVT00001183001; GSVIVT00002960001; GSVIVT00015470001; GSVIVT00015471001; GSVIVT00 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | vacuole | GO:0005773 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
| Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
| Sma3 | protein tyrosine kinase activity | GO:0004713 | Molecular Function | 0.0 | - |
| Sma3 | receptor activity | GO:0004872 | Molecular Function | 0.0 | - |
| Sma3 | calcium ion binding | GO:0005509 | Molecular Function | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
| Sma3 | protein autophosphorylation | GO:0046777 | Biological Process | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT1G79620.1 | Leucine-rich repeat protein kinase family protein chr1:29957633-29962174 REVERSE LENGTH=971 | 1.0e-13 | 90% |
| RefSeq | Arabidopsis thaliana | NP_178080.2 | leucine-rich repeat protein kinase-like protein [Arabidopsis thaliana] | 1.0e-13 | 90% |
| RefSeq | Populus trichocarpa | XP_002326254.1 | predicted protein [Populus trichocarpa] | 3.0e-13 | 87% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: I4DUG4
Fln msg: Distance to subject end: 149 aas, your sequence is shorter than subject: 34 - 892
Fln protein:
I
Protein Length:
35
Fln nts:
T
Fln Alignment:
HLKU4M003FLOEX___LHEHADPPIIHRDVKSTNILLDENMVAKVADFG
I4DUG4________________LHQGCNPPIIHRDIKCTNILLDARMNAKVADFG
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
