UniGene Name: sp_v3.0_unigene167043
Length: 215 nt
![]() |
---|
>sp_v3.0_unigene167043
G |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Unassigned protein | - | - | 0.0 | - |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 71% |
Sma3 | Pentatricopeptide repeat protein | - | - | 0.0 | - |
Source | Gene names |
---|---|
Sma3 | AP22.43; At1g09410; At2g02980; At2g22070; At3g08820; At3g57430; At4g14850; At4g16835; At4g33170; At4g33990; At4g37170; B1080A02.28; C7A10.190; DYW10; EMB2758; F14J9.7; F17I5.180; F17O14.29; F4I10.100; FCAALL.335; FCAALL.441; GSVIVT00000887001; GSVIVT00002 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
Sma3 | ribosome | GO:0005840 | Cellular Component | 0.0 | - |
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | nucleotide binding | GO:0000166 | Molecular Function | 0.0 | - |
Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
Sma3 | structural constituent of ribosome | GO:0003735 | Molecular Function | 0.0 | - |
Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
Sma3 | binding | GO:0005488 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | methyltransferase activity | GO:0008168 | Molecular Function | 0.0 | - |
Sma3 | translation | GO:0006412 | Biological Process | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Sma3 | metabolic process | GO:0008152 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Peptidase S8/S53, subtilisin/kexin/sedolisin | IPR000209 | - | 0.0 | - |
Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
Sma3 | Legume lectin domain | IPR001220 | - | 0.0 | - |
Sma3 | Mannose-binding lectin | IPR001229 | - | 0.0 | - |
Sma3 | Ribosomal protein S3, C-terminal | IPR001351 | - | 0.0 | - |
Sma3 | Pentatricopeptide repeat | IPR002885 | - | 0.0 | - |
Sma3 | Immunoglobulin/major histocompatibility complex, conserved site | IPR003006 | - | 0.0 | - |
Sma3 | K Homology domain, type 2 | IPR004044 | - | 0.0 | - |
Sma3 | K Homology domain | IPR004087 | - | 0.0 | - |
Sma3 | Uncharacterised protein family Cys-rich | IPR006461 | - | 0.0 | - |
Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
Sma3 | Tetratricopeptide-like helical | IPR011990 | - | 0.0 | - |
Sma3 | Methyltransferase type 11 | IPR013216 | - | 0.0 | - |
Sma3 | IPR017442 | - | 0.0 | - | |
Sma3 | IPR018115 | - | 0.0 | - | |
Sma3 | Asp/Glu racemase, active site | IPR018187 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT4G33170.1 | Tetratricopeptide repeat (TPR)-like superfamily protein chr4:15995701-15998673 REVERSE LENGTH=990 | 7.0e-23 | 59% |
RefSeq | Arabidopsis thaliana | NP_195043.1 | pentatricopeptide repeat-containing protein [Arabidopsis thaliana] | 9.0e-23 | 59% |
RefSeq | Populus trichocarpa | XP_002324099.1 | predicted protein [Populus trichocarpa] | 2.0e-24 | 64% |
![]() |
---|
Fln status: Putative C-terminus
Fln database: coniferopsida.fasta
Fln subject: D5AAE0
Fln msg: STOP codon was not found. Distance to subject end: 5 aas, your sequence is shorter than subject: 71 - 246
Fln protein:
K
Protein Length:
72
Fln nts:
G
Fln Alignment:
HLKU4M003G9HZJ___KEHNLKYHSEKLAIAFGLISLPCGTLVRIVKNLRMCPDCHTAAKFISNIVRREIILRDANHFHTFQE
D5AAE0________________KEHSLYHHSEKLAIAFGLISTLPGLPVRIIKNLRVCGDCHTATKFISKIVEREIIIRDANRFHHFKD
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain