UniGene Name: sp_v3.0_unigene167029
Length: 183 nt
UniGene Fasta
|
|---|
| >sp_v3.0_unigene167029
T |
Ace file of the UniGene sp_v3.0_unigene167029
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | rve domain containing protein | - | - | 2.0e-13 | 46% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 65% |
| Sma3 | Retrotransposon protein, putative, Ty1-copia subclass | - | - | 1.298e-12 | - |
| Source | Gene names |
|---|---|
| Sma3 | F11I4_21; GSVIVT00019821001; H0306F03.15; H0413E07.4; LOC_Os03g27910; LOC_Os03g46450; LOC_Os10g01450; LOC_Os10g18420; LOC_Os11g05840; LOC_Os11g17390; LOC_Os11g29320; LOC_Os12g01780; LOC_Os12g23320; LOC_Os12g31920; LOC_Os12g34770; OJ1008_D08.2; OSIGBa0127D |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | intracellular | GO:0005622 | Cellular Component | 0.0 | - |
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
| Sma3 | apoplast | GO:0048046 | Cellular Component | 0.0 | - |
| Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
| Sma3 | sequence-specific DNA binding transcription factor activity | GO:0003700 | Molecular Function | 0.0 | - |
| Sma3 | RNA-directed DNA polymerase activity | GO:0003964 | Molecular Function | 0.0 | - |
| Sma3 | aspartic-type endopeptidase activity | GO:0004190 | Molecular Function | 0.0 | - |
| Sma3 | endonuclease activity | GO:0004519 | Molecular Function | 0.0 | - |
| Sma3 | exonuclease activity | GO:0004527 | Molecular Function | 0.0 | - |
| Sma3 | ionotropic glutamate receptor activity | GO:0004970 | Molecular Function | 0.0 | - |
| Sma3 | extracellular-glutamate-gated ion channel activity | GO:0005234 | Molecular Function | 0.0 | - |
| Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
| Sma3 | manganese ion binding | GO:0030145 | Molecular Function | 0.0 | - |
| Sma3 | nutrient reservoir activity | GO:0045735 | Molecular Function | 0.0 | - |
| Sma3 | regulation of transcription, DNA-dependent | GO:0006355 | Biological Process | 0.0 | - |
| Sma3 | DNA integration | GO:0015074 | Biological Process | 0.0 | - |
| Sma3 | transposition | GO:0032196 | Biological Process | 0.0 | - |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LKX7
Fln msg: Distance to subject end: 149 aas, your sequence is shorter than subject: 61 - 407
Fln protein:
C
Protein Length:
62
Fln nts:
T
Fln Alignment:
HLKU4M003F5H80___LRSDNRGEYCSKEFVRYC*ENGILRGKTVPGTPQENGVSERMNRTIIERARCMRLHAR
B8LKX7________________LRTDNGKEYVNKEFDHYCKYNGIKREHTVPYTPQQNGVAERKNRTLMEMARCM-LHAR

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta