|
||||||
|
UniGene Name: sp_v3.0_unigene167028
Length: 232 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene167028
C |
|
Ace file of the UniGene sp_v3.0_unigene167028
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | putative strictosidine synthase [Oryza sativa Japonica Group] gb|ABF98899.1| Strictosidine synthase family protein, expressed [Oryza sativa Japonica Group] gb|EAY91875.1| hypothetical protein OsI_13523 [Oryza sativa Indica Group] | - | - | 9.0e-24 | 68% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 66% |
| Sma3 | Putative strictosidine synthase | - | - | 5.639e-16 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Strictosidine synthase. | EC:4.3.3.2 | - | 1.433e-12 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Indole alkaloid biosynthesis | 00901 | 1.433e-12 | % | |
| Sma3 | Biosynthesis of alkaloids derived from shikimate pathway | 01063 | 1.433e-12 | % | |
| Sma3 | Metabolic pathways | 01100 | 1.433e-12 | % | |
| Sma3 | Biosynthesis of secondary metabolites | 01110 | 1.433e-12 | % |
| Source | Gene names |
|---|---|
| Sma3 | At1g08470; At3g57030; At5g22020; F24I3.110; GSVIVT00000665001; GSVIVT00000666001; GSVIVT00003139001; GSVIVT00003163001; GSVIVT00003164001; GSVIVT00005321001; GSVIVT00007078001; GSVIVT00008019001; GSVIVT00011196001; GSVIVT00011947001; GSVIVT00017469001; GS |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | endoplasmic reticulum | GO:0005783 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | plant-type cell wall | GO:0009505 | Cellular Component | 0.0 | - |
| Sma3 | nucleotide binding | GO:0000166 | Molecular Function | 0.0 | - |
| Sma3 | nucleic acid binding | GO:0003676 | Molecular Function | 0.0 | - |
| Sma3 | strictosidine synthase activity | GO:0016844 | Molecular Function | 0.0 | - |
| Sma3 | biosynthetic process | GO:0009058 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | RNA recognition motif domain | IPR000504 | - | 0.0 | - |
| Sma3 | NHL repeat | IPR001258 | - | 0.0 | - |
| Sma3 | IPR004141 | - | 0.0 | - | |
| Sma3 | Six-bladed beta-propeller, TolB-like | IPR011042 | - | 0.0 | - |
| Sma3 | Nucleotide-binding, alpha-beta plait | IPR012677 | - | 0.0 | - |
| Sma3 | Strictosidine synthase, conserved region | IPR018119 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT1G08470.1 | SSL3 strictosidine synthase-like 3 chr1:2682262-2683977 REVERSE LENGTH=390 | 7.0e-30 | 65% |
| RefSeq | Arabidopsis thaliana | NP_563818.1 | strictosidine synthase-like 3 [Arabidopsis thaliana] | 9.0e-30 | 65% |
| RefSeq | Populus trichocarpa | XP_002298158.1 | predicted protein [Populus trichocarpa] | 2.0e-31 | 67% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NW47
Fln msg: Distance to subject end: 173 aas, your sequence is shorter than subject: 77 - 423
Fln protein:
H
Protein Length:
78
Fln nts:
C
Fln Alignment:
HLKU4M003GMR7J___TGDLYIADAYFGLLLVGSEGGLAKTIANEAEGVPFRFTNDLDFDEGGAIYFTDSSNNFQRRHFLLSIFSGDDTG
A9NW47________________TGDLYIADAYFGLLVVGPQGGLATPLATEAEGVPFKFTNDLDIDMDGNVYFTDSSTIYQRKNFIVLVFSAEDSG
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
