UniGene Name: sp_v3.0_unigene166751
Length: 229 nt
![]() |
---|
>sp_v3.0_unigene166751
T |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Unassigned protein | - | - | 0.0 | - |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 70% |
Sma3 | Leucine-rich repeat receptor-like protein kinase | - | - | 2.546e-19 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | [Tau protein] kinase. | EC:2.7.11.26 | - | 9.278e-14 | - |
Source | Gene names |
---|---|
Sma3 | 8F2.11; AP2_E06.2; AT1G48480; AT1G68400; AT2G26730; AT3G02880; AT3G08680; AT3G17840; AT4G23740; AT5G05160; AT5G16590; AT5G58300; At1g48480; At1g68400; At2g26730; At2g36570; At3g02880; At3g08680; At3g17840; At4g23740; At5g05160; At5g16590; At5g58300; B0812 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | cell wall | GO:0005618 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | plant-type cell wall | GO:0009505 | Cellular Component | 0.0 | - |
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | anchored to plasma membrane | GO:0046658 | Cellular Component | 0.0 | - |
Sma3 | protein kinase activity | GO:0004672 | Molecular Function | 0.0 | - |
Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
Sma3 | protein tyrosine kinase activity | GO:0004713 | Molecular Function | 0.0 | - |
Sma3 | receptor activity | GO:0004872 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Sma3 | response to symbiotic fungus | GO:0009610 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
Sma3 | Serine-threonine/tyrosine-protein kinase catalytic domain | IPR001245 | - | 0.0 | - |
Sma3 | Leucine-rich repeat | IPR001611 | - | 0.0 | - |
Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
Sma3 | Leucine-rich repeat-containing N-terminal, type 2 | IPR013210 | - | 0.0 | - |
Sma3 | SKG6/AXL2 alpha-helix transmembrane domain | IPR014805 | - | 0.0 | - |
Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
Sma3 | IPR017442 | - | 0.0 | - | |
Sma3 | Formate C-acetyltransferase glycine radical, conserved site | IPR019777 | - | 0.0 | - |
Sma3 | Peroxidases heam-ligand binding site | IPR019793 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT2G26730.1 | Leucine-rich repeat protein kinase family protein chr2:11388621-11391286 FORWARD LENGTH=658 | 2.0e-23 | 66% |
RefSeq | Arabidopsis thaliana | NP_180241.1 | putative inactive receptor kinase [Arabidopsis thaliana] | 2.0e-23 | 66% |
RefSeq | Populus trichocarpa | XP_002322122.1 | predicted protein [Populus trichocarpa] | 8.0e-25 | 81% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LN40
Fln msg: ERROR#3, very serious frame error, Overlapping hits, possible frame ERROR between 165 and 161, Distance to subject end: 60 aas, your sequence is shorter than subject: 77 - 340
Fln protein:
L
Protein Length:
78
Fln nts:
T
Fln Alignment:
HLKU4M003GXVVV___LSQKADVYSFGVLLLEVLTGKAPMHYHSQEEGVDLPKWVQSIVREEWTAEVFDLDLMRYKNIEEEMVSMLQIALSCVS
B8LN40________________VTQKSDVYSFGVLLLELLTGKAPNQASLNDEGIDLPRWVQSVVREEWTAEVFDVELMRYQNIEEEMVQLLQIAMACVA
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain