UniGene Name: sp_v3.0_unigene166744
Length: 225 nt
UniGene Fasta |
---|
>sp_v3.0_unigene166744
T |
Ace file of the UniGene sp_v3.0_unigene166744 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Transcription factor MYB32 n=2 Tax=Arabidopsis RepID=MYB32_ARATH | - | - | 3.0e-20 | 73% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 82% |
Sma3 | MYB transcription factor | - | - | 2.695e-30 | - |
Source | Gene names |
---|---|
Sma3 | At1g22640; At1g34670; At1g35515; At1g74080; At1g74650; At2g16720; At3g01140; At3g02940; At3g47600; At3g62610; At4g09460; At4g21440; At4g28110; At4g34990; At4g38620; At5g07690; At5g15310; At5g16770; At5g61420; At5g62470; B1267B06.13; C; C1; DcMYB2; F12K8.1 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
Sma3 | sequence-specific DNA binding transcription factor activity | GO:0003700 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | cysteine-type peptidase activity | GO:0008234 | Molecular Function | 0.0 | - |
Sma3 | cell morphogenesis | GO:0000902 | Biological Process | 0.0 | - |
Sma3 | regulation of transcription, DNA-dependent | GO:0006355 | Biological Process | 0.0 | - |
Sma3 | proteolysis | GO:0006508 | Biological Process | 0.0 | - |
Sma3 | response to wounding | GO:0009611 | Biological Process | 0.0 | - |
Sma3 | cold acclimation | GO:0009631 | Biological Process | 0.0 | - |
Sma3 | response to salt stress | GO:0009651 | Biological Process | 0.0 | - |
Sma3 | response to ethylene stimulus | GO:0009723 | Biological Process | 0.0 | - |
Sma3 | response to auxin stimulus | GO:0009733 | Biological Process | 0.0 | - |
Sma3 | response to abscisic acid stimulus | GO:0009737 | Biological Process | 0.0 | - |
Sma3 | response to gibberellin stimulus | GO:0009739 | Biological Process | 0.0 | - |
Sma3 | response to salicylic acid stimulus | GO:0009751 | Biological Process | 0.0 | - |
Sma3 | response to jasmonic acid stimulus | GO:0009753 | Biological Process | 0.0 | - |
Sma3 | cinnamic acid biosynthetic process | GO:0009800 | Biological Process | 0.0 | - |
Sma3 | negative regulation of metabolic process | GO:0009892 | Biological Process | 0.0 | - |
Sma3 | response to chitin | GO:0010200 | Biological Process | 0.0 | - |
Sma3 | response to UV-B | GO:0010224 | Biological Process | 0.0 | - |
Sma3 | cellular response to sulfur starvation | GO:0010438 | Biological Process | 0.0 | - |
Sma3 | regulation of glucosinolate biosynthetic process | GO:0010439 | Biological Process | 0.0 | - |
Sma3 | cell growth | GO:0016049 | Biological Process | 0.0 | - |
Sma3 | GO:0016481 | Biological Process | 0.0 | - | |
Sma3 | cuticle development | GO:0042335 | Biological Process | 0.0 | - |
Sma3 | GO:0045449 | Biological Process | 0.0 | - | |
Sma3 | response to cadmium ion | GO:0046686 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | SANT/Myb domain | IPR001005 | - | 0.0 | - |
Sma3 | Peptidase C48, SUMO/Sentrin/Ubl1 | IPR003653 | - | 0.0 | - |
Sma3 | Transposon, En/Spm-like | IPR004242 | - | 0.0 | - |
Sma3 | Myb-related protein P, C-terminal | IPR010588 | - | 0.0 | - |
Sma3 | IPR012287 | - | 0.0 | - | |
Sma3 | IPR014778 | - | 0.0 | - | |
Sma3 | Myb transcription factor | IPR015495 | - | 0.0 | - |
Sma3 | Myb-like domain | IPR017877 | - | 0.0 | - |
Sma3 | Myb domain, DNA-binding | IPR017930 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT4G34990.1 | AtMYB32, MYB32 myb domain protein 32 chr4:16661370-16662289 REVERSE LENGTH=274 | 4.0e-27 | 73% |
RefSeq | Arabidopsis thaliana | NP_195225.1 | transcription factor MYB32 [Arabidopsis thaliana] | 5.0e-27 | 73% |
RefSeq | Populus trichocarpa | XP_002312966.1 | predicted protein [Populus trichocarpa] | 5.0e-26 | 70% |
Full-Lengther Next Prediction |
---|
Fln status: N-terminus
Fln database: coniferopsida.fasta
Fln subject: A9NTK0
Fln msg: Distance to subject end: 184 aas, your sequence is shorter than subject: 57 - 242
Fln protein:
M
Protein Length:
58
Fln nts:
T
Fln Alignment:
HLKU4M003GQGSA___MGRGPCCANSDRNKGGWTKEEDDKLIQYIQAHGEGSWRSLPSTTGLRRCAKSCRLRW
A9NTK0________________MGRGPCCANGDRNKGAWTREEDDRLIQYIQAHGEGCWRSLPNASGLLRCGKSCRLRW
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain