|
||||||
|
UniGene Name: sp_v3.0_unigene166626
Length: 193 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
 UniGene Fasta (sense)
|
|---|
| >sp_v3.0_unigene166626
T |
|
Ace file of the UniGene sp_v3.0_unigene166626 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Putative polyprotein n=1 Tax=Zea mays RepID=Q8SA93_MAIZE | - | - | 2.0e-18 | 70% |
| FL-Next | sp=RNA-directed DNA polymerase homolog; berteroana). Mitochondrion. | - | - | 0.0 | 51% |
| Sma3 | Retrotransposon protein, putative, unclassified | - | - | 7.858e-20 | - |
| Source | Gene names |
|---|---|
| Sma3 | At2g05610; F23H6.1; H0124E07.6; H0211A12.9; H0321H01.8; H0502G05.6; LOC_Os03g05340; LOC_Os03g05350; LOC_Os03g06110; LOC_Os03g10000; LOC_Os03g13350; LOC_Os03g30350; LOC_Os03g47840; LOC_Os10g06110; LOC_Os10g13960; LOC_Os10g16560; LOC_Os10g16880; LOC_Os10g28 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | chromatin | GO:0000785 | Cellular Component | 0.0 | - |
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
| Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
| Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
| Sma3 | chromatin binding | GO:0003682 | Molecular Function | 0.0 | - |
| Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
| Sma3 | RNA-directed DNA polymerase activity | GO:0003964 | Molecular Function | 0.0 | - |
| Sma3 | carbonate dehydratase activity | GO:0004089 | Molecular Function | 0.0 | - |
| Sma3 | aspartic-type endopeptidase activity | GO:0004190 | Molecular Function | 0.0 | - |
| Sma3 | endonuclease activity | GO:0004519 | Molecular Function | 0.0 | - |
| Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | sugar binding | GO:0005529 | Molecular Function | 0.0 | - |
| Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
| Sma3 | RNA-dependent DNA replication | GO:0006278 | Biological Process | 0.0 | - |
| Sma3 | chromatin assembly or disassembly | GO:0006333 | Biological Process | 0.0 | - |
| Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
| Sma3 | proteolysis | GO:0006508 | Biological Process | 0.0 | - |
| Sma3 | DNA integration | GO:0015074 | Biological Process | 0.0 | - |
| Sma3 | carbon utilization | GO:0015976 | Biological Process | 0.0 | - |
| Full-Lengther Next Prediction |
|---|
Fln status: Putative C-terminus
Fln database: sp_plants
Fln subject: P31843
Fln msg: STOP codon was not found. Distance to subject end: 3 aas, your sequence is shorter than subject: 64 - 142
Fln protein:
Y
Protein Length:
65
Fln nts:
T
Fln Alignment:
HLKU4M003FV574___YEFKVMPFGLTNAPTTFQATMNEVLQPYLRKFVLVFFDYI---PIYSKTWKEHL-HLEQV
P31843________________FEFRVMPFGLTNALATFCNLMNNVLYEYLDHFVVVYLDDLVVYTIYSNSLHEHIKHLRVV
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
