|
||||||
|
UniGene Name: sp_v3.0_unigene166557
Length: 158 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene166557
T |
|
Ace file of the UniGene sp_v3.0_unigene166557
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Unassigned protein | - | - | 0.0 | - |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 69% |
| Sma3 | Putative pentatricopeptide (PPR) repeat-containing protein | - | - | 7.56e-10 | - |
| Source | Gene names |
|---|---|
| Sma3 | At1g68930; At1g74600; At2g22070; At3g47530; At3g49170; At4g02750; At4g13650; At4g33990; At5g04780; At5g48910; At5g66520; B1032F05.19; B1080A02.28; EMB2261; EMB2758; F17I5.180; F18A5.40; F1M20.28; F1P2.80; F2K15.30; GSVIVT00000138001; GSVIVT00000887001; GS |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
| Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
| Sma3 | protein tyrosine kinase activity | GO:0004713 | Molecular Function | 0.0 | - |
| Sma3 | binding | GO:0005488 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
| Sma3 | embryo development ending in seed dormancy | GO:0009793 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
| Sma3 | Beta-lactamase, class-A/D | IPR000871 | - | 0.0 | - |
| Sma3 | Mannose-binding lectin | IPR001229 | - | 0.0 | - |
| Sma3 | Serine-threonine/tyrosine-protein kinase catalytic domain | IPR001245 | - | 0.0 | - |
| Sma3 | Pentatricopeptide repeat | IPR002885 | - | 0.0 | - |
| Sma3 | Uncharacterised protein family UPF0497, trans-membrane plant | IPR006702 | - | 0.0 | - |
| Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
| Sma3 | Tetratricopeptide-like helical | IPR011990 | - | 0.0 | - |
| Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
| Sma3 | IPR017442 | - | 0.0 | - | |
| Sma3 | Asp/Glu racemase, active site | IPR018187 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT4G33990.1 | EMB2758 Tetratricopeptide repeat (TPR)-like superfamily protein chr4:16290141-16292612 REVERSE LENGTH=823 | 2.0e-17 | 69% |
| RefSeq | Arabidopsis thaliana | NP_567948.1 | pentatricopeptide repeat-containing protein [Arabidopsis thaliana] | 2.0e-17 | 69% |
| RefSeq | Populus trichocarpa | XP_002300569.1 | predicted protein, partial [Populus trichocarpa] | 6.0e-18 | 67% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: D5AD86
Fln msg: Distance to subject end: 178 aas, your sequence is shorter than subject: 52 - 514
Fln protein:
C
Protein Length:
53
Fln nts:
T
Fln Alignment:
HLKU4M003G2XL3___CMVDLLGRAGLLDKAEGFINSMPFKPDASIWWALLSACRVHGNMELGKSAAE
D5AD86________________CMIDLLGRAGCLDEAENFINGMPVEPDVSVWGALLGACRIHGNTELAKRIAE
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
