UniGene Name: sp_v3.0_unigene166457
Length: 247 nt
![]() |
---|
>sp_v3.0_unigene166457
C |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | 3-oxoacyl-(Acyl-carrier-protein) synthase n=2 Tax=Capsicum RepID=F1CCH2_CAPAN | - | - | 9.0e-10 | 80% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 75% |
Sma3 | Beta-ketoacyl-ACP synthase I | - | - | 9.316e-12 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Beta-ketoacyl-acyl-carrier-protein synthase I. | EC:2.3.1.41 | - | 3.438e-16 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Fatty acid biosynthesis | 00061 | 3.438e-16 | % | |
Sma3 | Metabolic pathways | 01100 | 3.438e-16 | % |
Source | Gene names |
---|---|
Sma3 | At5g46290; GSVIVT00003432001; GSVIVT00006723001; KAS I; KAS1; KAS12; KASI; Kas; MPL12.7; OSIGBa0140O07.8; OSJNBa0027P08.14; Os04g0445700; Os06g0196600; OsI_16057; OsI_22012; OsJ_14945; OsJ_20447; P0528E04.26; PHYPADRAFT_124905; PHYPADRAFT_125854; PHYPADRA |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | chloroplast stroma | GO:0009570 | Cellular Component | 0.0 | - |
Sma3 | chloroplast envelope | GO:0009941 | Cellular Component | 0.0 | - |
Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
Sma3 | catalytic activity | GO:0003824 | Molecular Function | 0.0 | - |
Sma3 | 3-oxoacyl-[acyl-carrier-protein] synthase activity | GO:0004315 | Molecular Function | 0.0 | - |
Sma3 | transferase activity, transferring acyl groups other than amino-acyl groups | GO:0016747 | Molecular Function | 0.0 | - |
Sma3 | fatty acid biosynthetic process | GO:0006633 | Biological Process | 0.0 | - |
Sma3 | biosynthetic process | GO:0009058 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Beta-ketoacyl synthase | IPR000794 | - | 0.0 | - |
Sma3 | Beta-ketoacyl synthase, N-terminal | IPR014030 | - | 0.0 | - |
Sma3 | Beta-ketoacyl synthase, C-terminal | IPR014031 | - | 0.0 | - |
Sma3 | Thiolase-like, subgroup | IPR016038 | - | 0.0 | - |
Sma3 | 3-oxoacyl-[acyl-carrier-protein] synthase 2 | IPR017568 | - | 0.0 | - |
Sma3 | Beta-ketoacyl synthase, active site | IPR018201 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT5G46290.3 | KASI 3-ketoacyl-acyl carrier protein synthase I chr5:18774439-18776629 REVERSE LENGTH=489 | 1.0e-12 | 72% |
RefSeq | Arabidopsis thaliana | NP_001032018.1 | 3-oxoacyl-[acyl-carrier-protein] synthase I [Arabidopsis thaliana] | 1.0e-12 | 72% |
RefSeq | Populus trichocarpa | XP_002303661.1 | predicted protein [Populus trichocarpa] | 1.0e-13 | 77% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: D5ABC3
Fln msg: Distance to subject end: 33 aas, your sequence is shorter than subject: 82 - 481
Fln protein:
N
Protein Length:
83
Fln nts:
C
Fln Alignment:
HLKU4M003GURS0___NYINAHATSTQAGDLREVKAIKNVFKDTSGIKMNGTKAVL
D5ABC3________________NYINAHATSTRAGDLAEVNAIKKVFTNTSSIKMNGTKSMI
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain