UniGene Name: sp_v3.0_unigene166365
Length: 242 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
UniGene Fasta (sense) |
---|
>sp_v3.0_unigene166365
T |
Ace file of the UniGene sp_v3.0_unigene166365 (antisense) |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | putative DNA replication licensing factor [Arabidopsis thaliana] | - | - | 1.0e-22 | 74% |
FL-Next | sp=Protein PROLIFERA; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 66% |
Sma3 | Minichromosome maintenance protein | - | - | 2.626e-10 | - |
Source | Gene names |
---|---|
Sma3 | AGAA.2; At2g07690; At2g14050; At2g16440; At3g09660; At4g02060; At5g44635; At5g46280; B37; CHLREDRAFT_108537; CHLREDRAFT_113236; CHLREDRAFT_115083; CHLREDRAFT_122561; CHLREDRAFT_127391; CHLREDRAFT_127671; CHLREDRAFT_152683; CHLREDRAFT_171623; F11F8_25; GSV |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | intracellular | GO:0005622 | Cellular Component | 0.0 | - |
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
Sma3 | calcium ion binding | GO:0005509 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | oxidoreductase activity | GO:0016491 | Molecular Function | 0.0 | - |
Sma3 | acid-amino acid ligase activity | GO:0016881 | Molecular Function | 0.0 | - |
Sma3 | nucleoside-triphosphatase activity | GO:0017111 | Molecular Function | 0.0 | - |
Sma3 | DNA-dependent DNA replication initiation | GO:0006270 | Biological Process | 0.0 | - |
Sma3 | regulation of transcription, DNA-dependent | GO:0006355 | Biological Process | 0.0 | - |
Sma3 | protein modification process | GO:0006464 | Biological Process | 0.0 | - |
Sma3 | ubiquitin-dependent protein catabolic process | GO:0006511 | Biological Process | 0.0 | - |
Sma3 | cell cycle | GO:0007049 | Biological Process | 0.0 | - |
Sma3 | sugar mediated signaling pathway | GO:0010182 | Biological Process | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT2G14050.1 | MCM9 minichromosome maintenance 9 chr2:5909240-5913817 FORWARD LENGTH=646 | 1.0e-31 | 92% |
RefSeq | Arabidopsis thaliana | NP_179021.3 | minichromosome maintenance 9 [Arabidopsis thaliana] | 1.0e-31 | 92% |
RefSeq | Populus trichocarpa | XP_002325759.1 | predicted protein [Populus trichocarpa] | 2.0e-32 | 95% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: sp_plants
Fln subject: P43299
Fln msg: Distance to subject end: 245 aas, your sequence is shorter than subject: 80 - 716
Fln protein:
A
Protein Length:
81
Fln nts:
T
Fln Alignment:
HLKU4M003HJQV1___EWMLEAGALVLADGGLCCIDEFDSIREPDRATIHEAMEQQTISVAKAGLVT
P43299________________EMVLEGGALVLADMGICAIDEFDKMDESDRTAIHEVMEQQTVSIAKAGITT
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain