UniGene Name: sp_v3.0_unigene166339
Length: 222 nt
UniGene Fasta
|
|---|
| >sp_v3.0_unigene166339
C |
Ace file of the UniGene sp_v3.0_unigene166339
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Receptor-like kinase n=1 Tax=Marchantia polymorpha RepID=A7VM40_MARPO | - | - | 1.0e-21 | 72% |
| FL-Next | tr=Uncharacterized protein; Cryptomeria japonica (Japanese cedar) (Cupressus japonica). | - | - | 0.0 | 67% |
| Sma3 | Kinase, putative | - | - | 1.3e-13 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Non-specific protein-tyrosine kinase. | EC:2.7.10.2 | - | 3.829e-19 | - |
| Sma3 | Mitogen-activated protein kinase kinase kinase. | EC:2.7.11.25 | - | 4.321e-07 | - |
| Source | Gene names |
|---|---|
| Sma3 | AT1G79620; AT4g00330; AT4g39110; AT5G48740; AT5G49760; AT5G49770; A_IG005I10.8; At1g30570; At1g79620; At1g79620/F20B17_5; At2g21480; At2g39360; At3g04690; At3g46290; At3g51550; At4g00330; At4g39110; At5g24010; At5g28680; At5g38990; At5g39000; At5g49760; A |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | vacuole | GO:0005773 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
| Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
| Sma3 | nucleic acid binding | GO:0003676 | Molecular Function | 0.0 | - |
| Sma3 | protein kinase activity | GO:0004672 | Molecular Function | 0.0 | - |
| Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
| Sma3 | protein tyrosine kinase activity | GO:0004713 | Molecular Function | 0.0 | - |
| Sma3 | receptor activity | GO:0004872 | Molecular Function | 0.0 | - |
| Sma3 | calcium ion binding | GO:0005509 | Molecular Function | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
| Sma3 | protein autophosphorylation | GO:0046777 | Biological Process | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT2G39360.1 | Protein kinase superfamily protein chr2:16437592-16440039 REVERSE LENGTH=815 | 2.0e-25 | 64% |
| RefSeq | Arabidopsis thaliana | NP_181468.1 | putative receptor-like protein kinase [Arabidopsis thaliana] | 2.0e-25 | 64% |
| RefSeq | Populus trichocarpa | XP_002301786.1 | predicted protein [Populus trichocarpa] | 3.0e-27 | 71% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: I4DUG4
Fln msg: Distance to subject end: 87 aas, your sequence is shorter than subject: 73 - 892
Fln protein:
S
Protein Length:
74
Fln nts:
C
Fln Alignment:
HLKU4M003F02JB___KLADFGLSRMAIDGEATHITTAVKGTFGYLDPEYFNTQMLTEKSDVYSFGVVLLEIICGRA
I4DUG4________________KVADFGLAKL-LDRSQTYVSTAVKGTIGYLDPEYFETASLTAKSDVYSFGVVLLEIISGKS

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta