|
||||||
|
UniGene Name: sp_v3.0_unigene166338
Length: 203 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene166338
T |
|
Ace file of the UniGene sp_v3.0_unigene166338
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | LRR receptor-like serine/threonine-protein kinase HSL2 n=2 Tax=Arabidopsis RepID=HSL2_ARATH | - | - | 7.0e-16 | 61% |
| FL-Next | tr=Clavata-like receptor; Picea glauca (White spruce) (Pinus glauca). | - | - | 0.0 | 55% |
| Sma3 | Receptor protein kinase CLAVATA1, putative | - | - | 1.199e-18 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | 2-alkenal reductase. | EC:1.3.1.74 | - | 6.275e-16 | - |
| Sma3 | Mitogen-activated protein kinase kinase kinase. | EC:2.7.11.25 | - | 2.741e-16 | - |
| Source | Gene names |
|---|---|
| Sma3 | AT1G08590; AT1G09970; AT1G34110; AT2G33170; AT3G49670; AT4G28490; AT5G62230; AT5G63930; AT5G65700; AT5G65710; At1g08590; At1g09970; At1g09970/F21M12.36; At2g33170; At3g24240; At3g49670; At4g28490; At5g62230/mmi9_50; At5g63930; At5g65700; ERL1; ERL1c; ERL1 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
| Sma3 | protein kinase activity | GO:0004672 | Molecular Function | 0.0 | - |
| Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
| Sma3 | receptor activity | GO:0004872 | Molecular Function | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | oxidoreductase activity | GO:0016491 | Molecular Function | 0.0 | - |
| Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
| Sma3 | embryo sac development | GO:0009553 | Biological Process | 0.0 | - |
| Sma3 | regulation of meristem structural organization | GO:0009934 | Biological Process | 0.0 | - |
| Sma3 | regulation of meristem growth | GO:0010075 | Biological Process | 0.0 | - |
| Sma3 | stomatal complex morphogenesis | GO:0010103 | Biological Process | 0.0 | - |
| Sma3 | microsporocyte differentiation | GO:0010480 | Biological Process | 0.0 | - |
| Sma3 | interspecies interaction between organisms | GO:0044419 | Biological Process | 0.0 | - |
| Sma3 | protein autophosphorylation | GO:0046777 | Biological Process | 0.0 | - |
| Sma3 | gametophyte development | GO:0048229 | Biological Process | 0.0 | - |
| Sma3 | ovule development | GO:0048481 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
| Sma3 | Leucine-rich repeat | IPR001611 | - | 0.0 | - |
| Sma3 | Short-chain dehydrogenase/reductase SDR | IPR002198 | - | 0.0 | - |
| Sma3 | Glucose/ribitol dehydrogenase | IPR002347 | - | 0.0 | - |
| Sma3 | Leucine-rich repeat, typical subtype | IPR003591 | - | 0.0 | - |
| Sma3 | Aminotransferases, class-I, pyridoxal-phosphate-binding site | IPR004838 | - | 0.0 | - |
| Sma3 | Retrotransposon gag protein | IPR005162 | - | 0.0 | - |
| Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
| Sma3 | Leucine-rich repeat-containing N-terminal, type 2 | IPR013210 | - | 0.0 | - |
| Sma3 | NAD(P)-binding domain | IPR016040 | - | 0.0 | - |
| Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
| Sma3 | IPR017442 | - | 0.0 | - | |
| Sma3 | Aldo/keto reductase, conserved site | IPR018170 | - | 0.0 | - |
| Sma3 | Asp/Glu racemase, active site | IPR018187 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT5G65710.1 | HSL2 HAESA-like 2 chr5:26292372-26295440 FORWARD LENGTH=993 | 6.0e-21 | 61% |
| RefSeq | Arabidopsis thaliana | NP_201372.2 | LRR receptor-like serine/threonine-protein kinase HSL2 [Arabidopsis thaliana] | 8.0e-21 | 61% |
| RefSeq | Populus trichocarpa | XP_002304699.1 | predicted protein [Populus trichocarpa] | 7.0e-20 | 58% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: Q19AV8
Fln msg: Distance to subject end: 100 aas, your sequence is shorter than subject: 67 - 998
Fln protein:
E
Protein Length:
68
Fln nts:
T
Fln Alignment:
HLKU4M003GHXS2___HLADFGIAKILDNIHPMGCTVSGVPGSVGYIAPEYGFSSRVNEKSDVYSYGIVLLELLTGKQP
Q19AV8________________HVADFGVAKILQSCARGADSMSAIAGSYGYIAPEYAYTLKVNEKSDIYSFGVVILELVTGRRP
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
