UniGene Name: sp_v3.0_unigene166319
Length: 227 nt
UniGene Fasta |
---|
>sp_v3.0_unigene166319
C |
Ace file of the UniGene sp_v3.0_unigene166319 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | UDP-glucosyltransferase (Fragment) n=7 Tax=Picea RepID=F1C8U2_PICAB | - | - | 1.0e-20 | 61% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 84% |
Sma3 | UDP-glucose:glucosyltransferase | - | - | 9.936e-10 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Transferases, Glycosyltransferases, Hexosyltransferases. | EC:2.4.1.- | - | 2.054e-09 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Anthocyanin biosynthesis | 00942 | 2.079e-07 | % | |
Sma3 | Metabolic pathways | 01100 | 2.079e-07 | % | |
Sma3 | Biosynthesis of secondary metabolites | 01110 | 2.079e-07 | % |
Source | Gene names |
---|---|
Sma3 | AmUGT21; GSVIVT00000585001; GSVIVT00000586001; GSVIVT00000587001; GSVIVT00005849001; GSVIVT00005859001; GSVIVT00031473001; GSVIVT00031475001; GSVIVT00031477001; GSVIVT00037549001; NTGT1a; NTGT1b; NtGT3; OSIGBa0153E02-OSIGBa0093I20.9; OSJNBb0065J09.10; Os0 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | transferase activity, transferring hexosyl groups | GO:0016758 | Molecular Function | 0.0 | - |
Sma3 | metabolic process | GO:0008152 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | UDP-glucuronosyl/UDP-glucosyltransferase | IPR002213 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G01390.1 | UDP-Glycosyltransferase superfamily protein chr1:148319-149761 REVERSE LENGTH=480 | 2.0e-19 | 46% |
RefSeq | Arabidopsis thaliana | NP_171646.1 | hydroquinone glucosyltransferase [Arabidopsis thaliana] | 3.0e-19 | 46% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: C0PRA8
Fln msg: Distance to subject end: 70 aas, your sequence is shorter than subject: 75 - 514
Fln protein:
L
Protein Length:
76
Fln nts:
C
Fln Alignment:
HLKU4M003GW7XT___LSHPSVGAFLSHCGWNSTLESVSLGIPVITWPMFAEQSFNSMFLVKILGIGVQVCLDMDNVADEEDVRRAVTMLL
C0PRA8________________LSHPSVGAFLSHCGWNSTLESVSLAVPMITWPMFAEQPFNSKFLVEKLGIGIQICLDMSSVANEEDVRRAVTMLL
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain