UniGene Name: sp_v3.0_unigene166184
Length: 193 nt
UniGene Fasta
|
|---|
| >sp_v3.0_unigene166184
C |
Ace file of the UniGene sp_v3.0_unigene166184
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | 4-coumarate:CoA ligase n=2 Tax=Populus trichocarpa RepID=B2Z6P2_POPTR | - | - | 9.0e-21 | 79% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 93% |
| Sma3 | Acyl:coa ligase | - | - | 5.336e-35 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Photinus-luciferin 4-monooxygenase (ATP-hydrolyzing). | EC:1.13.12.7 | - | 8.213e-36 | - |
| Sma3 | Ligases, Forming carbon-sulfur bonds, Acid--thiol ligases. | EC:6.2.1.- | - | 0.0 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Geraniol degradation | 00281 | 0.0 | % | |
| Sma3 | Tyrosine metabolism | 00350 | 0.0 | % | |
| Sma3 | Benzoate degradation | 00362 | 0.0 | % | |
| Sma3 | Fluorobenzoate degradation | 00364 | 0.0 | % | |
| Sma3 | alpha-Linolenic acid metabolism | 00592 | 0.0 | % | |
| Sma3 | Aminobenzoate degradation | 00627 | 0.0 | % | |
| Sma3 | Propanoate metabolism | 00640 | 0.0 | % | |
| Sma3 | Ethylbenzene degradation | 00642 | 0.0 | % | |
| Sma3 | Carbon fixation pathways in prokaryotes | 00720 | 0.0 | % | |
| Sma3 | Limonene and pinene degradation | 00903 | 0.0 | % | |
| Sma3 | Tropane, piperidine and pyridine alkaloid biosynthesis | 00960 | 0.0 | % | |
| Sma3 | Biosynthesis of plant hormones | 01070 | 0.0 | % | |
| Sma3 | Metabolic pathways | 01100 | 0.0 | % | |
| Sma3 | Biosynthesis of secondary metabolites | 01110 | 0.0 | % | |
| Sma3 | 4-coumarate--CoA ligase. | EC:6.2.1.12 | - | 0.0 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Ubiquinone and other terpenoid-quinone biosynthesis | 00130 | 0.0 | % | |
| Sma3 | Phenylalanine metabolism | 00360 | 0.0 | % | |
| Sma3 | Phenylpropanoid biosynthesis | 00940 | 0.0 | % | |
| Sma3 | Biosynthesis of phenylpropanoids | 01061 | 0.0 | % | |
| Sma3 | Biosynthesis of alkaloids derived from shikimate pathway | 01063 | 0.0 | % | |
| Sma3 | Metabolic pathways | 01100 | 0.0 | % | |
| Sma3 | Biosynthesis of secondary metabolites | 01110 | 0.0 | % |
| Source | Gene names |
|---|---|
| Sma3 | 4CL; 4CL-1; 4CL-2; 4CL-2a; 4CL-A; 4CL-A1; 4CL-A2; 4CL-A3; 4CL-B; 4CL-D; 4CL.2; 4CL1; 4CL2; 4CL3; 4CL4; 4CLL1; 4CLL2; 4CLL3; 4CLL4; 4CLL5; 4CLL6; 4CLL7; 4CLL8; 4CLL9; 4cl; ABG-1; ACLL13; ACLL14; ACLL15; ACLL16; ACLL18|Ptr4CL13; ACLL20; ACLL21; At1g20480; A |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | peroxisome | GO:0005777 | Cellular Component | 0.0 | - |
| Sma3 | catalytic activity | GO:0003824 | Molecular Function | 0.0 | - |
| Sma3 | fatty-acyl-CoA synthase activity | GO:0004321 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | 4-coumarate-CoA ligase activity | GO:0016207 | Molecular Function | 0.0 | - |
| Sma3 | ligase activity | GO:0016874 | Molecular Function | 0.0 | - |
| Sma3 | metabolic process | GO:0008152 | Biological Process | 0.0 | - |
| Sma3 | jasmonic acid biosynthetic process | GO:0009695 | Biological Process | 0.0 | - |
| Sma3 | phenylpropanoid metabolic process | GO:0009698 | Biological Process | 0.0 | - |
| Sma3 | phenylpropanoid biosynthetic process | GO:0009699 | Biological Process | 0.0 | - |
| Sma3 | oxylipin biosynthetic process | GO:0031408 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Regulator of chromosome condensation, RCC1 | IPR000408 | - | 0.0 | - |
| Sma3 | AMP-dependent synthetase/ligase | IPR000873 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT1G20510.1 | OPCL1 OPC-8:0 CoA ligase1 chr1:7103645-7105856 REVERSE LENGTH=546 | 2.0e-24 | 71% |
| RefSeq | Arabidopsis thaliana | NP_564115.1 | OPC-8:0 CoA ligase1 [Arabidopsis thaliana] | 2.0e-24 | 71% |
| RefSeq | Populus trichocarpa | XP_002318710.1 | acyl:coa ligase [Populus trichocarpa] | 4.0e-27 | 79% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: D5A7S8
Fln msg: Distance to subject end: 47 aas, your sequence is shorter than subject: 64 - 163
Fln protein:
I
Protein Length:
65
Fln nts:
C
Fln Alignment:
HLKU4M003FSELR___IVDRIKELIKYKAYQVAPAELEELLLSNVEISDAAVIPYPDDEAGQIPMAFIVRKSDSNLSEED
D5A7S8________________VVDRIKELIKYKAFQVAPAELEELLLSNQEISDAAVIPYPDDEAGQIPMAFVVRKSDSNLSEED

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta