UniGene Name: sp_v3.0_unigene166135
Length: 185 nt
![]() |
---|
>sp_v3.0_unigene166135
T |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Nucleoside diphosphate kinase n=3 Tax=Caenorhabditis RepID=Q93576_CAEEL | - | - | 2.0e-21 | 80% |
FL-Next | sp=Nucleoside diphosphate kinase; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 62% |
Sma3 | Nucleoside diphosphate kinase | - | - | 0.0 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Nucleoside-diphosphate kinase. | EC:2.7.4.6 | - | 0.0 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Purine metabolism | 00230 | 0.0 | % | |
Sma3 | Pyrimidine metabolism | 00240 | 0.0 | % | |
Sma3 | Metabolic pathways | 01100 | 0.0 | % | |
Sma3 | Biosynthesis of secondary metabolites | 01110 | 0.0 | % |
Source | Gene names |
---|---|
Sma3 | At4g09320; Bc-NDPK1; BcNDK I; CHLREDRAFT_180172; CHLREDRAFT_58944; FAP103; LOC_Os10g41410; MICPUCDRAFT_60912; MICPUN_88956; MICPUN_98189; NDK1; NDK2; NDKN1; NDKP1; NDPK; NDPK 1; NDPK1; OSJNBa0027P10.4; OSTLU_27292; Os10g0563700; OsI_34670; OsJ_32481; Ot15 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | vacuole | GO:0005773 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | flagellum | GO:0019861 | Cellular Component | 0.0 | - |
Sma3 | apoplast | GO:0048046 | Cellular Component | 0.0 | - |
Sma3 | magnesium ion binding | GO:0000287 | Molecular Function | 0.0 | - |
Sma3 | nucleoside diphosphate kinase activity | GO:0004550 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | GTP biosynthetic process | GO:0006183 | Biological Process | 0.0 | - |
Sma3 | UTP biosynthetic process | GO:0006228 | Biological Process | 0.0 | - |
Sma3 | CTP biosynthetic process | GO:0006241 | Biological Process | 0.0 | - |
Sma3 | red, far-red light phototransduction | GO:0009585 | Biological Process | 0.0 | - |
Sma3 | response to salt stress | GO:0009651 | Biological Process | 0.0 | - |
Sma3 | red or far-red light signaling pathway | GO:0010017 | Biological Process | 0.0 | - |
Sma3 | response to cadmium ion | GO:0046686 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Nucleoside diphosphate kinase | IPR001564 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT4G09320.1 | NDPK1 Nucleoside diphosphate kinase family protein chr4:5923424-5924366 FORWARD LENGTH=169 | 5.0e-20 | 59% |
RefSeq | Arabidopsis thaliana | NP_567346.1 | nucleoside diphosphate kinase 1 [Arabidopsis thaliana] | 6.0e-20 | 59% |
RefSeq | Populus trichocarpa | XP_002326861.1 | predicted protein [Populus trichocarpa] | 4.0e-20 | 59% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NZL7
Fln msg: Distance to subject end: 22 aas, your sequence is shorter than subject: 61 - 144
Fln protein:
I
Protein Length:
62
Fln nts:
T
Fln Alignment:
HLKU4M003G02P9___IKYMASGPVLAFVIQGLDAVKTGRAMLGATNPLASLPGTIRGDFCLVTGRNICHGSDAVES
A9NZL7________________VEYIISGPVVAMVWEGKGVVATGRKIIGATNPAASEPGTIRGDFAVEIGRNVIHGSDAVES
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain