UniGene Name: sp_v3.0_unigene166072
Length: 245 nt
![]() |
---|
>sp_v3.0_unigene166072
A |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Class IV chitinase Chia4-Pa1.3 n=8 Tax=Picea RepID=Q6WSS1_PICAB | - | - | 3.0e-37 | 92% |
FL-Next | tr=Class IV chitinase A; Pinus monticola (Western white pine) (Strobus monticola). | - | - | 0.0 | 94% |
Sma3 | Class IV chitinase | - | - | 1.352e-22 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Chitinase. | EC:3.2.1.14 | - | 7.509e-16 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Amino sugar and nucleotide sugar metabolism | 00520 | 7.509e-16 | % |
Source | Gene names |
---|---|
Sma3 | At2g43590; Bcchi; CHB4; Ch4; Ch4A; Chi4; Chi4C; Chi4D; Cht; Cht4; GSVIVT00034623001; GSVIVT00034628001; GSVIVT00034629001; GSVIVT00034634001; GSVIVT00034636001; GSVIVT00034638001; GSVIVT00034642001; GSVIVT00034647001; H0522A01.12; NaCHIT1; NtChitIV; OSIGB |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | extracellular region | GO:0005576 | Cellular Component | 0.0 | - |
Sma3 | chitinase activity | GO:0004568 | Molecular Function | 0.0 | - |
Sma3 | chitin binding | GO:0008061 | Molecular Function | 0.0 | - |
Sma3 | polysaccharide catabolic process | GO:0000272 | Biological Process | 0.0 | - |
Sma3 | chitin catabolic process | GO:0006032 | Biological Process | 0.0 | - |
Sma3 | defense response | GO:0006952 | Biological Process | 0.0 | - |
Sma3 | cell wall macromolecule catabolic process | GO:0016998 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | ATPase, F1/V1/A1 complex, alpha/beta subunit, nucleotide-binding domain | IPR000194 | - | 0.0 | - |
Sma3 | Glycoside hydrolase, family 19, catalytic | IPR000726 | - | 0.0 | - |
Sma3 | Chitin-binding, type 1 | IPR001002 | - | 0.0 | - |
Sma3 | EGF-like region, conserved site | IPR013032 | - | 0.0 | - |
Sma3 | Aldehyde dehydrogenase, conserved site | IPR016160 | - | 0.0 | - |
Sma3 | Glycoside hydrolase, family 19 | IPR016283 | - | 0.0 | - |
Sma3 | Chitin-binding, type 1, conserved site | IPR018371 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT2G43590.1 | Chitinase family protein chr2:18081592-18082749 REVERSE LENGTH=264 | 2.0e-26 | 55% |
RefSeq | Arabidopsis thaliana | NP_181887.1 | chitinase-like protein [Arabidopsis thaliana] | 2.0e-26 | 55% |
RefSeq | Populus trichocarpa | XP_002339637.1 | predicted protein, partial [Populus trichocarpa] | 9.0e-25 | 56% |
![]() |
---|
Fln status: C-terminus
Fln database: coniferopsida.fasta
Fln subject: Q596H9
Fln msg: your sequence is shorter than subject: 79 - 273
Fln protein:
E
Protein Length:
80
Fln nts:
A
Fln Alignment:
HLKU4M003GZS8E___EKVGQDSTISFKTAVWFWMDNSNCHTAITSGQGFGGTIKAINSQECNGGNSGEVNSRVNYYKNICNQLGVDPGANVSC
Q596H9________________EKVGQDSTISFKTAVWFWMKNSNCHSAITSGQGFGGTIKAINSQECNGGNSGEVNSRVNYYKNICSQLGVDPGANLSC
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain