UniGene Name: sp_v3.0_unigene166017
Length: 179 nt
![]() |
---|
>sp_v3.0_unigene166017
G |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Os03g0571900 protein n=1 Tax=Oryza sativa Japonica Group RepID=Q0DQQ2_ORYSJ | - | - | 3.0e-10 | 82% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 97% |
Sma3 | Multidrug resistance pump, putative | - | - | 1.011e-15 | - |
Source | Gene names |
---|---|
Sma3 | 117M18_23; AT4G21910; AT4g21910; AT4g25640; At1g11670; At1g33080; At1g33090; At1g33100; At1g33110; At1g61890; At3g21690; At4g21910; At4g25640; At5g17700; At5g65380; DDTFR18; F8K4.9; F9L11.22; F9L11.23; GSVIVT00009471001; GSVIVT00010745001; GSVIVT000107460 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
Sma3 | RNA-directed DNA polymerase activity | GO:0003964 | Molecular Function | 0.0 | - |
Sma3 | aspartic-type endopeptidase activity | GO:0004190 | Molecular Function | 0.0 | - |
Sma3 | drug transmembrane transporter activity | GO:0015238 | Molecular Function | 0.0 | - |
Sma3 | antiporter activity | GO:0015297 | Molecular Function | 0.0 | - |
Sma3 | RNA-dependent DNA replication | GO:0006278 | Biological Process | 0.0 | - |
Sma3 | proteolysis | GO:0006508 | Biological Process | 0.0 | - |
Sma3 | drug transmembrane transport | GO:0006855 | Biological Process | 0.0 | - |
Sma3 | DNA integration | GO:0015074 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Reverse transcriptase | IPR000477 | - | 0.0 | - |
Sma3 | Integrase, catalytic core | IPR001584 | - | 0.0 | - |
Sma3 | Peptidase M1, alanine aminopeptidase/leukotriene A4 hydrolase | IPR001930 | - | 0.0 | - |
Sma3 | Multi antimicrobial extrusion protein | IPR002528 | - | 0.0 | - |
Sma3 | Peptidase M1, alanyl aminopeptidase | IPR012779 | - | 0.0 | - |
Sma3 | Peptidase M1, membrane alanine aminopeptidase, N-terminal | IPR014782 | - | 0.0 | - |
Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
Sma3 | Chaperonin Cpn60, conserved site | IPR018370 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G11670.1 | MATE efflux family protein chr1:3928520-3931482 REVERSE LENGTH=503 | 6.0e-13 | 65% |
RefSeq | Arabidopsis thaliana | NP_172632.1 | MATE efflux family protein [Arabidopsis thaliana] | 7.0e-13 | 65% |
RefSeq | Populus trichocarpa | XP_002317105.1 | predicted protein [Populus trichocarpa] | 6.0e-14 | 66% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: D5ADQ8
Fln msg: Distance to subject end: 374 aas, your sequence is shorter than subject: 59 - 517
Fln protein:
E
Protein Length:
60
Fln nts:
G
Fln Alignment:
HLKU4M003GJPK8___LGMGSAVETLCGQAYGAKNYGMLGIYLQRSTILLMV
D5ADQ8________________LGMGSAVETLCGQAYGAKTYGMLGIYLQRSTILLMV
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain