UniGene Name: sp_v3.0_unigene165892
Length: 200 nt
UniGene Fasta |
---|
>sp_v3.0_unigene165892
C |
Ace file of the UniGene sp_v3.0_unigene165892 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Putative retrotransposon protein n=1 Tax=Phyllostachys edulis RepID=D3IVJ7_9POAL | - | - | 1.0e-16 | 59% |
FL-Next | tr=Retrotransposon protein, putative, Ty3-gypsy sub-class; Oryza sativa subsp. japonica (Rice). | - | - | 0.0 | 57% |
Sma3 | Retrotransposon protein, putative, Ty3-gypsy subclass | - | - | 1.368e-36 | - |
Source | Gene names |
---|---|
Sma3 | B1159F04.11; H0207B04.5; H0409D10.7; H0502B11.9; H0502G05.10; H0512B01.1; H0616A11.3; H0807C06-H0308C08.9; LOC_Os03g15160; LOC_Os03g23110; LOC_Os03g23220; LOC_Os03g23780; LOC_Os03g23800; LOC_Os03g23830; LOC_Os03g23840; LOC_Os03g23860; LOC_Os03g29790; LOC_ |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | chromatin | GO:0000785 | Cellular Component | 0.0 | - |
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
Sma3 | chromatin binding | GO:0003682 | Molecular Function | 0.0 | - |
Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
Sma3 | RNA-directed DNA polymerase activity | GO:0003964 | Molecular Function | 0.0 | - |
Sma3 | aspartic-type endopeptidase activity | GO:0004190 | Molecular Function | 0.0 | - |
Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
Sma3 | transferase activity | GO:0016740 | Molecular Function | 0.0 | - |
Sma3 | RNA-dependent DNA replication | GO:0006278 | Biological Process | 0.0 | - |
Sma3 | chromatin assembly or disassembly | GO:0006333 | Biological Process | 0.0 | - |
Sma3 | proteolysis | GO:0006508 | Biological Process | 0.0 | - |
Sma3 | DNA integration | GO:0015074 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Reverse transcriptase | IPR000477 | - | 0.0 | - |
Sma3 | Chromo domain/shadow | IPR000953 | - | 0.0 | - |
Sma3 | Integrase, catalytic core | IPR001584 | - | 0.0 | - |
Sma3 | Zinc finger, CCHC-type | IPR001878 | - | 0.0 | - |
Sma3 | Peptidase aspartic, active site | IPR001969 | - | 0.0 | - |
Sma3 | Retrotransposon gag protein | IPR005162 | - | 0.0 | - |
Sma3 | Domain of unknown function DUF834 | IPR008552 | - | 0.0 | - |
Sma3 | IPR013084 | - | 0.0 | - | |
Sma3 | Retroviral aspartyl protease | IPR013242 | - | 0.0 | - |
Full-Lengther Next Prediction |
---|
Fln status: Putative C-terminus
Fln database: tr_plants
Fln subject: Q53JF0
Fln msg: STOP codon was not found. Distance to subject end: 4 aas, your sequence is shorter than subject: 66 - 158
Fln protein:
P
Protein Length:
67
Fln nts:
C
Fln Alignment:
HLKU4M003GCVNA___PVRDTYDVADVARVFINEIIRFHGVPKKIISDRDSQFTSIFWTCMQTALGTQLNLSTAYHPETDGQ
Q53JF0________________PVHTTYSGKKLAELYLARVMCLHGVPKKIVSDRESQFTSKFWQKLQEELGTRLNFSTAYHPQTDGQ
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain