|
||||||
|
UniGene Name: sp_v3.0_unigene165643
Length: 178 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
 UniGene Fasta (sense)
|
|---|
| >sp_v3.0_unigene165643
G |
|
Ace file of the UniGene sp_v3.0_unigene165643 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Unassigned protein | - | - | 0.0 | - |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 90% |
| Sma3 | Pentatricopeptide, putative, expressed | - | - | 7.109e-08 | - |
| Source | Gene names |
|---|---|
| Sma3 | At1g09410; At1g11290; At1g18485; At1g20230; At1g56690; At1g68930; At2g22070; At3g02010; At3g03580; At3g12770; At3g24000; At3g26782; At3g46790; At3g49170; At3g57430; At4g02750; At4g16835; At4g30700; At4g33170; At4g33990; At4g37380; At5g06540; At5g09950; At |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
| Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
| Sma3 | endonuclease activity | GO:0004519 | Molecular Function | 0.0 | - |
| Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
| Sma3 | binding | GO:0005488 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | methyltransferase activity | GO:0008168 | Molecular Function | 0.0 | - |
| Sma3 | acireductone synthase activity | GO:0043874 | Molecular Function | 0.0 | - |
| Sma3 | metal ion binding | GO:0046872 | Molecular Function | 0.0 | - |
| Sma3 | DNA methylation | GO:0006306 | Biological Process | 0.0 | - |
| Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
| Sma3 | metabolic process | GO:0008152 | Biological Process | 0.0 | - |
| Sma3 | embryo development ending in seed dormancy | GO:0009793 | Biological Process | 0.0 | - |
| Sma3 | mRNA modification | GO:0016556 | Biological Process | 0.0 | - |
| Sma3 | L-methionine salvage from methylthioadenosine | GO:0019509 | Biological Process | 0.0 | - |
| Sma3 | chloroplast RNA processing | GO:0031425 | Biological Process | 0.0 | - |
| Sma3 | polycistronic mRNA processing | GO:0031426 | Biological Process | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT1G11290.1 | CRR22 Pentatricopeptide repeat (PPR) superfamily protein chr1:3791454-3793883 REVERSE LENGTH=809 | 1.0e-25 | 75% |
| RefSeq | Arabidopsis thaliana | NP_172596.1 | pentatricopeptide repeat-containing protein [Arabidopsis thaliana] | 2.0e-25 | 75% |
| RefSeq | Populus trichocarpa | XP_002303960.1 | predicted protein [Populus trichocarpa] | 5.0e-25 | 77% |
| Full-Lengther Next Prediction |
|---|
Fln status: C-terminus
Fln database: coniferopsida.fasta
Fln subject: B8LQA8
Fln msg: your sequence is shorter than subject: 54 - 795
Fln protein:
G
Protein Length:
55
Fln nts:
G
Fln Alignment:
HLKU4M003GMICF___GNPIHIMKNLRVCSDCHNATKFISKIVGREIIVRDSNRFHHFKNGLCSCGDYW
B8LQA8________________GIPIRIMKNLRVCSDCHNATKFISKIVGREIIVRDANRFHHVKNGFCSCGDYW
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
