|
||||||
|
UniGene Name: sp_v3.0_unigene165620
Length: 236 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
 UniGene Fasta (sense)
|
|---|
| >sp_v3.0_unigene165620
G |
|
Ace file of the UniGene sp_v3.0_unigene165620 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Os01g0128000 protein n=3 Tax=Oryza sativa RepID=Q0JR06_ORYSJ | - | - | 1.0e-31 | 75% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 74% |
| Sma3 | MYB transcription factor | - | - | 3.855e-23 | - |
| Source | Gene names |
|---|---|
| Sma3 | AIM1; AT4g13480; AT4g26930; At1g25340; At1g48000; At1g68320; At2g32460; At2g47190; At3g01530; At3g01530/F4P13_8; At3g06490; At3g24310; At3g27810; At3g30210; At3g46130; At4g13480; At4g26930; At5g40350; At5g49620; At5g55020; At5g59780; Atmyb2; F10M23.270; F |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
| Sma3 | sequence-specific DNA binding transcription factor activity | GO:0003700 | Molecular Function | 0.0 | - |
| Sma3 | catalytic activity | GO:0003824 | Molecular Function | 0.0 | - |
| Sma3 | calmodulin binding | GO:0005516 | Molecular Function | 0.0 | - |
| Sma3 | transcription activator activity | GO:0016563 | Molecular Function | 0.0 | - |
| Sma3 | regulation of transcription, DNA-dependent | GO:0006355 | Biological Process | 0.0 | - |
| Sma3 | red, far-red light phototransduction | GO:0009585 | Biological Process | 0.0 | - |
| Sma3 | response to salt stress | GO:0009651 | Biological Process | 0.0 | - |
| Sma3 | response to ethylene stimulus | GO:0009723 | Biological Process | 0.0 | - |
| Sma3 | response to auxin stimulus | GO:0009733 | Biological Process | 0.0 | - |
| Sma3 | response to abscisic acid stimulus | GO:0009737 | Biological Process | 0.0 | - |
| Sma3 | response to gibberellin stimulus | GO:0009739 | Biological Process | 0.0 | - |
| Sma3 | gibberellic acid mediated signaling pathway | GO:0009740 | Biological Process | 0.0 | - |
| Sma3 | response to salicylic acid stimulus | GO:0009751 | Biological Process | 0.0 | - |
| Sma3 | response to jasmonic acid stimulus | GO:0009753 | Biological Process | 0.0 | - |
| Sma3 | positive regulation of abscisic acid mediated signaling pathway | GO:0009789 | Biological Process | 0.0 | - |
| Sma3 | flower development | GO:0009908 | Biological Process | 0.0 | - |
| Sma3 | red or far-red light signaling pathway | GO:0010017 | Biological Process | 0.0 | - |
| Sma3 | response to chitin | GO:0010200 | Biological Process | 0.0 | - |
| Sma3 | cell differentiation | GO:0030154 | Biological Process | 0.0 | - |
| Sma3 | GO:0045449 | Biological Process | 0.0 | - | |
| Sma3 | response to cadmium ion | GO:0046686 | Biological Process | 0.0 | - |
| Sma3 | stamen development | GO:0048443 | Biological Process | 0.0 | - |
| Sma3 | flavonol biosynthetic process | GO:0051555 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | SANT/Myb domain | IPR001005 | - | 0.0 | - |
| Sma3 | Phosphoglycerate/bisphosphoglycerate mutase, active site | IPR001345 | - | 0.0 | - |
| Sma3 | Phosphopantetheine attachment site | IPR006162 | - | 0.0 | - |
| Sma3 | IPR012287 | - | 0.0 | - | |
| Sma3 | IPR014778 | - | 0.0 | - | |
| Sma3 | Myb transcription factor | IPR015495 | - | 0.0 | - |
| Sma3 | Transcription factor, GAMYB | IPR016310 | - | 0.0 | - |
| Sma3 | Myb-like domain | IPR017877 | - | 0.0 | - |
| Sma3 | Myb domain, DNA-binding | IPR017930 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT5G59780.3 | MYB59, ATMYB59-3 myb domain protein 59 chr5:24082425-24083350 REVERSE LENGTH=235 | 2.0e-40 | 72% |
| RefSeq | Arabidopsis thaliana | NP_200786.1 | transcription factor MYB59 [Arabidopsis thaliana] | 2.0e-40 | 72% |
| RefSeq | Populus trichocarpa | XP_002313452.1 | predicted protein, partial [Populus trichocarpa] | 1.99993e-41 | 77% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LLD7
Fln msg: Distance to subject end: 179 aas, your sequence is shorter than subject: 78 - 295
Fln protein:
G
Protein Length:
79
Fln nts:
G
Fln Alignment:
HLKU4M003GX6L4___GRWSFLAKATGLNRTGKSCRLRWLNYLRPNLKRSKITPEEERLIIDLHSRFGNRWSRIAQSLPGRTDNEIKNYWRTRI
B8LLD7________________GRWSALAKASGLQRCGKSCRLRWVNYLRPDLKRGSITPEEESIILDLHARWGNRWSLIAEKMPGRTDNEIKNYWRSHL
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
