UniGene Name: sp_v3.0_unigene165396
Length: 154 nt
UniGene Fasta
|
|---|
| >sp_v3.0_unigene165396
C |
Ace file of the UniGene sp_v3.0_unigene165396
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Peptidyl-prolyl cis-trans isomerase n=3 Tax=Agaricomycetes RepID=B8PMM3_POSPM | - | - | 5.0e-10 | 63% |
| FL-Next | sp=Peptidyl-prolyl cis-trans isomerase; Pinus taeda (Loblolly pine). | - | - | 0.0 | 77% |
| Sma3 | Peptidyl-prolyl cis-trans isomerase | - | - | 0.0 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Peptidylprolyl isomerase. | EC:5.2.1.8 | - | 0.0 | - |
| Source | Gene names |
|---|---|
| Sma3 | 43H1; 46C02.10; 56B23-g9; At2g16600; At2g21130; At2g29960; At2g38730; At3g55920; At3g56070; At3g62030; At4g34870; At4g38740; At5g58710; B1331F11.9; CHLREDRAFT_136386; CHLREDRAFT_183823; CHLREDRAFT_185571; CHLREDRAFT_196289; CHLREDRAFT_28893; CHLREDRAFT_30 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | extracellular region | GO:0005576 | Cellular Component | 0.0 | - |
| Sma3 | membrane fraction | GO:0005624 | Cellular Component | 0.0 | - |
| Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
| Sma3 | multivesicular body | GO:0005771 | Cellular Component | 0.0 | - |
| Sma3 | vacuole | GO:0005773 | Cellular Component | 0.0 | - |
| Sma3 | endoplasmic reticulum | GO:0005783 | Cellular Component | 0.0 | - |
| Sma3 | Golgi stack | GO:0005795 | Cellular Component | 0.0 | - |
| Sma3 | cytosol | GO:0005829 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast thylakoid membrane | GO:0009535 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast stroma | GO:0009570 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast envelope | GO:0009941 | Cellular Component | 0.0 | - |
| Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
| Sma3 | cytosolic ribosome | GO:0022626 | Cellular Component | 0.0 | - |
| Sma3 | thylakoid lumen | GO:0031977 | Cellular Component | 0.0 | - |
| Sma3 | apoplast | GO:0048046 | Cellular Component | 0.0 | - |
| Sma3 | peptidyl-prolyl cis-trans isomerase activity | GO:0003755 | Molecular Function | 0.0 | - |
| Sma3 | binding | GO:0005488 | Molecular Function | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | peptide binding | GO:0042277 | Molecular Function | 0.0 | - |
| Sma3 | protein folding | GO:0006457 | Biological Process | 0.0 | - |
| Sma3 | response to oxidative stress | GO:0006979 | Biological Process | 0.0 | - |
| Sma3 | plant-type hypersensitive response | GO:0009626 | Biological Process | 0.0 | - |
| Sma3 | response to light intensity | GO:0009642 | Biological Process | 0.0 | - |
| Sma3 | response to salt stress | GO:0009651 | Biological Process | 0.0 | - |
| Sma3 | response to mannitol stimulus | GO:0010555 | Biological Process | 0.0 | - |
| Sma3 | cysteine biosynthetic process | GO:0019344 | Biological Process | 0.0 | - |
| Sma3 | defense response to bacterium | GO:0042742 | Biological Process | 0.0 | - |
| Sma3 | response to cadmium ion | GO:0046686 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Peptidyl-prolyl cis-trans isomerase, FKBP-type, domain | IPR001179 | - | 0.0 | - |
| Sma3 | Tetratricopeptide TPR-1 | IPR001440 | - | 0.0 | - |
| Sma3 | Cyclophilin-like peptidyl-prolyl cis-trans isomerase domain | IPR002130 | - | 0.0 | - |
| Sma3 | CS-like domain | IPR007052 | - | 0.0 | - |
| Sma3 | Tetratricopeptide-like helical | IPR011990 | - | 0.0 | - |
| Sma3 | Tetratricopeptide repeat-containing domain | IPR013026 | - | 0.0 | - |
| Sma3 | Tetratricopeptide TPR2 | IPR013105 | - | 0.0 | - |
| Sma3 | CS domain | IPR017447 | - | 0.0 | - |
| Sma3 | Tetratricopeptide repeat | IPR019734 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT4G34870.1 | ROC5, ATCYP1 rotamase cyclophilin 5 chr4:16614451-16614969 FORWARD LENGTH=172 | 1.0e-13 | 76% |
| RefSeq | Arabidopsis thaliana | NP_195213.1 | Peptidyl-prolyl cis-trans isomerase CYP18-4 [Arabidopsis thaliana] | 2.0e-13 | 76% |
| RefSeq | Populus trichocarpa | XP_002313736.1 | predicted protein [Populus trichocarpa] | 2.0e-12 | 75% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A5HIY2
Fln msg: Distance to subject end: 62 aas, your sequence is shorter than subject: 50 - 171
Fln protein:
I
Protein Length:
51
Fln nts:
C
Fln Alignment:
HLKU4M003G6SER___FHRVIPDFMCQXXXXXXXXXXXXXSIYGDKFPDENFTEKHTSAGLLSMA
A5HIY2________________FHRVIPGFMCQGGDFTAGNGTGGESIYGNKFPDENFVKKHTGPGILSMA

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta