UniGene Name: sp_v3.0_unigene165204
Length: 118 nt
UniGene Fasta |
---|
>sp_v3.0_unigene165204
C |
Ace file of the UniGene sp_v3.0_unigene165204 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Protoporphyrinogen IX oxidase n=1 Tax=Glycine max RepID=Q9SLW5_SOYBN | - | - | 1.0e-10 | 84% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 97% |
Sma3 | Protoporphyrinogen IX oxidase | - | - | 9.303e-12 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Protoporphyrinogen oxidase. | EC:1.3.3.4 | - | 6.474e-14 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Porphyrin and chlorophyll metabolism | 00860 | 6.474e-14 | % | |
Sma3 | Metabolic pathways | 01100 | 6.474e-14 | % | |
Sma3 | Biosynthesis of secondary metabolites | 01110 | 6.474e-14 | % |
Source | Gene names |
---|---|
Sma3 | At5g14220; F18O22_10; GSVIVT00020543001; OSJNBa0076N16.4; OSJNBa0084K20.6; OsI_16415; OsJ_15280; PHYPADRAFT_123617; POPTRDRAFT_797922; POX2; PPOX2; PPX2; PPX2L; PPXII; RCOM_1678480; VITISV_008740; hemG; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
Sma3 | mitochondrial inner membrane | GO:0005743 | Cellular Component | 0.0 | - |
Sma3 | chloroplast inner membrane | GO:0009706 | Cellular Component | 0.0 | - |
Sma3 | chloroplast envelope | GO:0009941 | Cellular Component | 0.0 | - |
Sma3 | oxygen-dependent protoporphyrinogen oxidase activity | GO:0004729 | Molecular Function | 0.0 | - |
Sma3 | binding | GO:0005488 | Molecular Function | 0.0 | - |
Sma3 | electron carrier activity | GO:0009055 | Molecular Function | 0.0 | - |
Sma3 | porphyrin-containing compound biosynthetic process | GO:0006779 | Biological Process | 0.0 | - |
Sma3 | heme biosynthetic process | GO:0006783 | Biological Process | 0.0 | - |
Sma3 | chlorophyll biosynthetic process | GO:0015995 | Biological Process | 0.0 | - |
Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | IPR000759 | - | 0.0 | - | |
Sma3 | Amine oxidase | IPR002937 | - | 0.0 | - |
Sma3 | Mitochodrial transcription termination factor-related | IPR003690 | - | 0.0 | - |
Sma3 | Protoporphyrinogen oxidase | IPR004572 | - | 0.0 | - |
Sma3 | NAD(P)-binding domain | IPR016040 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT5G14220.1 | HEMG2, MEE61, PPO2 Flavin containing amine oxidoreductase family chr5:4583506-4587369 REVERSE LENGTH=508 | 2.0e-14 | 80% |
RefSeq | Arabidopsis thaliana | NP_001190307.1 | protoporphyrinogen oxidase [Arabidopsis thaliana] | 2.0e-14 | 80% |
RefSeq | Populus trichocarpa | XP_002298607.1 | predicted protein [Populus trichocarpa] | 5.0e-15 | 81% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LQQ3
Fln msg: Distance to subject end: 121 aas, your sequence is shorter than subject: 38 - 494
Fln protein:
L
Protein Length:
39
Fln nts:
C
Fln Alignment:
HA8LWWM01C1V7B___LEGFGVLVPSKEEKNGFQTLGTLFSSNMFPDRAPTDQY
B8LQQ3________________LEGFGILVPSKEEKNGFQTLGTLFSSNMFPDRAPTDQY
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain