UniGene Name: sp_v3.0_unigene165202
Length: 160 nt
UniGene Fasta |
---|
>sp_v3.0_unigene165202
A |
Ace file of the UniGene sp_v3.0_unigene165202 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | DNA-directed RNA polymerase (Fragment) n=1 Tax=Ginkgo biloba RepID=Q1L6W2_GINBI | - | - | 3.0e-18 | 80% |
FL-Next | sp=DNA-directed RNA polymerase II subunit RPB2; Solanum lycopersicum (Tomato) (Lycopersicon esculentum). | - | - | 0.0 | 61% |
Sma3 | DNA-directed RNA polymerase | - | - | 7.894e-26 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | DNA-directed RNA polymerase. | EC:2.7.7.6 | - | 6.829e-24 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Purine metabolism | 00230 | 6.829e-24 | % | |
Sma3 | Pyrimidine metabolism | 00240 | 6.829e-24 | % | |
Sma3 | Metabolic pathways | 01100 | 6.829e-24 | % |
Source | Gene names |
---|---|
Sma3 | B0414F07.4; GSVIVT00018575001; GSVIVT00032775001; LOC_Os03g44484; MICPUCDRAFT_31670; MICPUN_93697; OJ1590_E05.24; OSJNBa0063C18.1; OSJNBb0079B02.6; OSTLU_13673; Os03g0646800; Os04g0641000; Os08g0171600; OsI_12811; OsI_17620; OsI_27986; OsJ_11898; OsJ_1635 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
Sma3 | DNA-directed RNA polymerase activity | GO:0003899 | Molecular Function | 0.0 | - |
Sma3 | ribonucleoside binding | GO:0032549 | Molecular Function | 0.0 | - |
Sma3 | GO:0006350 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | DNA-directed RNA polymerase, subunit 2, domain 6 | IPR007120 | - | 0.0 | - |
Sma3 | RNA polymerase, beta subunit, conserved site | IPR007121 | - | 0.0 | - |
Sma3 | RNA polymerase Rpb2, domain 7 | IPR007641 | - | 0.0 | - |
Sma3 | RNA polymerase Rpb2, domain 2 | IPR007642 | - | 0.0 | - |
Sma3 | RNA polymerase, beta subunit, protrusion | IPR007644 | - | 0.0 | - |
Sma3 | RNA polymerase Rpb2, domain 3 | IPR007645 | - | 0.0 | - |
Sma3 | RNA polymerase Rpb2, domain 4 | IPR007646 | - | 0.0 | - |
Sma3 | RNA polymerase Rpb2, domain 5 | IPR007647 | - | 0.0 | - |
Sma3 | DNA-directed RNA polymerase, subunit 2 | IPR015712 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT4G21710.1 | NRPB2, EMB1989, RPB2 DNA-directed RNA polymerase family protein chr4:11535684-11542200 REVERSE LENGTH=1188 | 2.0e-15 | 59% |
RefSeq | Arabidopsis thaliana | NP_193902.1 | DNA-directed RNA polymerase II subunit RPB2 [Arabidopsis thaliana] | 2.0e-15 | 59% |
RefSeq | Populus trichocarpa | XP_002324332.1 | predicted protein [Populus trichocarpa] | 2.0e-16 | 66% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q42877
Fln msg: Distance to subject end: 174 aas, your sequence is shorter than subject: 53 - 1191
Fln protein:
G
Protein Length:
54
Fln nts:
A
Fln Alignment:
HA8LWWM01D7QVP___GIVPDIIINPHAFPSRQTPGQLFECALGKAIAASGLVGDATPFRPITVESIT
Q42877________________GITPDIIVNPHAIPSRMTIGQLIECIMGKVAAHMGKEGDATPFTDVTVDNIS
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain