UniGene Name: sp_v3.0_unigene165130
Length: 228 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
UniGene Fasta (sense)
|
|---|
| >sp_v3.0_unigene165130
G |
Ace file of the UniGene sp_v3.0_unigene165130 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | OSJNBa0035O13.13 protein n=1 Tax=Oryza sativa Japonica Group RepID=Q7XSL7_ORYSJ | - | - | 4.0e-16 | 55% |
| FL-Next | tr=Putative uncharacterized protein; Asparagus officinalis (Garden asparagus). | - | - | 0.0 | 65% |
| Sma3 | Retrotransposon protein, putative, Ty3-gypsy subclass | - | - | 1.657e-22 | - |
| Source | Gene names |
|---|---|
| Sma3 | 19.t00005; AT4g10580; At2g04670; At2g07660; At2g10780; B1160F02.4; H0124B04.16; H0211F06-OSIGBa0153M17.10; H0409D10.7; H0502G05.10; H0616A11.3; H0624F09.1; H0807C06-H0308C08.9; H0818H01.18; LOC_Os03g15160; LOC_Os03g23110; LOC_Os03g23120; LOC_Os03g23220; L |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | chromatin | GO:0000785 | Cellular Component | 0.0 | - |
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
| Sma3 | nucleic acid binding | GO:0003676 | Molecular Function | 0.0 | - |
| Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
| Sma3 | chromatin binding | GO:0003682 | Molecular Function | 0.0 | - |
| Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
| Sma3 | actin binding | GO:0003779 | Molecular Function | 0.0 | - |
| Sma3 | RNA-directed DNA polymerase activity | GO:0003964 | Molecular Function | 0.0 | - |
| Sma3 | aspartic-type endopeptidase activity | GO:0004190 | Molecular Function | 0.0 | - |
| Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
| Sma3 | RNA-dependent DNA replication | GO:0006278 | Biological Process | 0.0 | - |
| Sma3 | chromatin assembly or disassembly | GO:0006333 | Biological Process | 0.0 | - |
| Sma3 | proteolysis | GO:0006508 | Biological Process | 0.0 | - |
| Sma3 | cytoskeleton organization | GO:0007010 | Biological Process | 0.0 | - |
| Sma3 | DNA integration | GO:0015074 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | ATPase, F1/V1/A1 complex, alpha/beta subunit, nucleotide-binding domain | IPR000194 | - | 0.0 | - |
| Sma3 | Reverse transcriptase | IPR000477 | - | 0.0 | - |
| Sma3 | Chromo domain/shadow | IPR000953 | - | 0.0 | - |
| Sma3 | Integrase, catalytic core | IPR001584 | - | 0.0 | - |
| Sma3 | Zinc finger, CCHC-type | IPR001878 | - | 0.0 | - |
| Sma3 | Peptidase aspartic, active site | IPR001969 | - | 0.0 | - |
| Sma3 | Putative S-adenosyl-L-methionine-dependent methyltransferase | IPR004159 | - | 0.0 | - |
| Sma3 | Auxin efflux carrier | IPR004776 | - | 0.0 | - |
| Sma3 | Retrotransposon gag protein | IPR005162 | - | 0.0 | - |
| Sma3 | IPR013084 | - | 0.0 | - | |
| Sma3 | Retroviral aspartyl protease | IPR013242 | - | 0.0 | - |
| Sma3 | Zinc finger, H2C2-type, histone UAS binding | IPR015416 | - | 0.0 | - |
| Sma3 | IPR015706 | - | 0.0 | - |
Full-Lengther Next Prediction |
|---|
Fln status: Putative N-terminus
Fln database: tr_plants
Fln subject: Q2AA41
Fln msg: Distance to subject end: 265 aas, W2: There is no M at the beginning, your sequence is shorter than subject: 75 - 335
Fln protein:
G
Protein Length:
76
Fln nts:
G
Fln Alignment:
HA8LWWM01BRBFA___ILQQDVTLPNIGMYRLSALENAEIKKQGQELLEKGFIRPSTSPCGSPIVLVRKKDGSWRMCIDYRALNK
Q2AA41________________MLTDESSLPNIGLYRTSVQESEEIKKQVQELLEMGVIVPSCSPCGSSVLLVLKKDGGWLMCMDYRALNK

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta (sense)