UniGene Name: sp_v3.0_unigene165120
Length: 188 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
UniGene Fasta (sense) |
---|
>sp_v3.0_unigene165120
T |
Ace file of the UniGene sp_v3.0_unigene165120 (antisense) |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | E-alpha-bisabolene synthase n=1 Tax=Picea abies RepID=Q675L6_PICAB | - | - | 3.0e-28 | 95% |
FL-Next | tr=E-alpha-bisabolene synthase; Picea abies (Norway spruce) (Picea excelsa). | - | - | 0.0 | 95% |
Sma3 | Copalyl diphosphate synthase | - | - | 6.953e-32 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Levopimaradiene synthase. | EC:4.2.3.32 | - | 6.972e-12 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Diterpenoid biosynthesis | 00904 | 6.972e-12 | % | |
Sma3 | Biosynthesis of secondary metabolites | 01110 | 6.972e-12 | % | |
Sma3 | Copalyl diphosphate synthase. | EC:5.5.1.12 | - | 2.512e-19 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Diterpenoid biosynthesis | 00904 | 2.512e-19 | % | |
Sma3 | Biosynthesis of terpenoids and steroids | 01062 | 2.512e-19 | % | |
Sma3 | Metabolic pathways | 01100 | 2.512e-19 | % | |
Sma3 | Biosynthesis of secondary metabolites | 01110 | 2.512e-19 | % | |
Sma3 | Ent-copalyl diphosphate synthase. | EC:5.5.1.13 | - | 1.394e-10 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Diterpenoid biosynthesis | 00904 | 1.394e-10 | % | |
Sma3 | Biosynthesis of terpenoids and steroids | 01062 | 1.394e-10 | % | |
Sma3 | Biosynthesis of plant hormones | 01070 | 1.394e-10 | % | |
Sma3 | Metabolic pathways | 01100 | 1.394e-10 | % | |
Sma3 | Biosynthesis of secondary metabolites | 01110 | 1.394e-10 | % |
Source | Gene names |
---|---|
Sma3 | ABS; AN1; An2; CPS; CPS1; CPS2; CPSL1; CmCPS1; Cpps1; DTC2; KS11; KSL11; KSL8; LOC_Os02g17780; LOC_Os11g28530; LPS; LsCPS1; OSJNBa0035G04.5; OSJNBb0051H02.22; Os02g0278700; Os09g0319800; Os11g0474800; OsI_034856; OsI_06748; OsI_36076; OsJ_06244; OsJ_28845 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | magnesium ion binding | GO:0000287 | Molecular Function | 0.0 | - |
Sma3 | ent-copalyl diphosphate synthase activity | GO:0009905 | Molecular Function | 0.0 | - |
Sma3 | lyase activity | GO:0016829 | Molecular Function | 0.0 | - |
Sma3 | carbon-oxygen lyase activity, acting on phosphates | GO:0016838 | Molecular Function | 0.0 | - |
Sma3 | manganese ion binding | GO:0030145 | Molecular Function | 0.0 | - |
Sma3 | abietadiene synthase activity | GO:0050554 | Molecular Function | 0.0 | - |
Sma3 | copalyl diphosphate synthase activity | GO:0050559 | Molecular Function | 0.0 | - |
Sma3 | metabolic process | GO:0008152 | Biological Process | 0.0 | - |
Sma3 | gibberellin metabolic process | GO:0009685 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Prenyltransferase/squalene oxidase | IPR001330 | - | 0.0 | - |
Sma3 | Terpene synthase-like | IPR001906 | - | 0.0 | - |
Sma3 | Terpene synthase, metal-binding domain | IPR005630 | - | 0.0 | - |
Sma3 | Terpenoid synthase | IPR008949 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT4G02780.1 | GA1, ABC33, ATCPS1, CPS, CPS1 Terpenoid cyclases/Protein prenyltransferases superfamily protein chr4:1237881-1244766 REVERSE LENGTH=802 | 2.0e-14 | 54% |
RefSeq | Arabidopsis thaliana | NP_192187.1 | Ent-copalyl diphosphate synthase [Arabidopsis thaliana] | 3.0e-14 | 54% |
RefSeq | Populus trichocarpa | XP_002302110.1 | copalyl diphosphate synthase [Populus trichocarpa] | 2.0e-18 | 59% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: Q675L6
Fln msg: Distance to subject end: 673 aas, your sequence is shorter than subject: 62 - 807
Fln protein:
P
Protein Length:
63
Fln nts:
T
Fln Alignment:
HA8LWWM01E11QZ___PSAYDSAWVARVPSVDGSVCPQFPQTVEWILKNQLKDGSWGTESHFLLSDRLLATLSCVLAL
Q675L6________________PSAYDTAWVARVPSIDGSACPQFPQTVEWILKNQLKDGSWGTESHFLLSDRLLATLSCVLAL
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain