UniGene Name: sp_v3.0_unigene165111
Length: 134 nt
UniGene Fasta |
---|
>sp_v3.0_unigene165111
A |
Ace file of the UniGene sp_v3.0_unigene165111 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | DNA replication licensing factor mcm5 [Cryptosporidium hominis TU502] gb|EAL36732.1| DNA replication licensing factor mcm5 [Cryptosporidium hominis] | - | - | 2.0e-10 | 91% |
FL-Next | sp=Protein PROLIFERA; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 80% |
Sma3 | MCM2-related protein | - | - | 1.939e-07 | - |
Source | Gene names |
---|---|
Sma3 | AGAA.2; At2g07690; At4g02060; At5g44635; At5g46280; B37; CHLREDRAFT_115083; CHLREDRAFT_127391; CHLREDRAFT_127671; CHLREDRAFT_152683; CHLREDRAFT_171623; GSVIVT00003433001; GSVIVT00005616001; GSVIVT00006228001; GSVIVT00028109001; LOC_Os11g29380; LOC_Os12g37 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
Sma3 | calcium ion binding | GO:0005509 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | oxidoreductase activity | GO:0016491 | Molecular Function | 0.0 | - |
Sma3 | nucleoside-triphosphatase activity | GO:0017111 | Molecular Function | 0.0 | - |
Sma3 | DNA-dependent DNA replication initiation | GO:0006270 | Biological Process | 0.0 | - |
Sma3 | regulation of transcription, DNA-dependent | GO:0006355 | Biological Process | 0.0 | - |
Sma3 | cell cycle | GO:0007049 | Biological Process | 0.0 | - |
Sma3 | sugar mediated signaling pathway | GO:0010182 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Mini-chromosome maintenance, DNA-dependent ATPase | IPR001208 | - | 0.0 | - |
Sma3 | DNA methylase, N-6 adenine-specific, conserved site | IPR002052 | - | 0.0 | - |
Sma3 | AAA+ ATPase domain | IPR003593 | - | 0.0 | - |
Sma3 | FAD dependent oxidoreductase | IPR006076 | - | 0.0 | - |
Sma3 | Mini-chromosome maintenance complex protein 2 | IPR008045 | - | 0.0 | - |
Sma3 | Mini-chromosome maintenance complex protein 3 | IPR008046 | - | 0.0 | - |
Sma3 | Mini-chromosome maintenance complex protein 5 | IPR008048 | - | 0.0 | - |
Sma3 | Mini-chromosome maintenance complex protein 6 | IPR008049 | - | 0.0 | - |
Sma3 | Mini-chromosome maintenance complex protein 7 | IPR008050 | - | 0.0 | - |
Sma3 | Glycoside hydrolase, family 16, active site | IPR008263 | - | 0.0 | - |
Sma3 | EF-hand-like domain | IPR011992 | - | 0.0 | - |
Sma3 | Nucleic acid-binding, OB-fold | IPR012340 | - | 0.0 | - |
Sma3 | NAD(P)-binding domain | IPR016040 | - | 0.0 | - |
Sma3 | Homeobox, conserved site | IPR017970 | - | 0.0 | - |
Sma3 | Mini-chromosome maintenance, conserved site | IPR018525 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT2G07690.1 | MCM5 Minichromosome maintenance (MCM2/3/5) family protein chr2:3523379-3527388 REVERSE LENGTH=727 | 8.0e-15 | 97% |
RefSeq | Arabidopsis thaliana | NP_001189521.1 | minichromosome maintenance protein 5 (cell division control protein 46) [Arabidopsis thaliana] | 1.0e-14 | 97% |
RefSeq | Populus trichocarpa | XP_002325153.1 | predicted protein, partial [Populus trichocarpa] | 7.0e-15 | 97% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: sp_plants
Fln subject: P43299
Fln msg: Distance to subject end: 233 aas, your sequence is shorter than subject: 44 - 716
Fln protein:
I
Protein Length:
45
Fln nts:
A
Fln Alignment:
HA8LWWM01BJ7SY___IDEFDKMRAEDRVAIHEAMEQQTISIAKAGITTVL
P43299________________IDEFDKMDESDRTAIHEVMEQQTVSIAKAGITTSL
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain