SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene165050

Length: 214 nt

UniGene Fasta

>sp_v3.0_unigene165050
AAATTCTAAACTCAAAACATTTGGCTTACAGGAGGAGAAGGGGCCTGTTGTTTTAATTGTTAATGCATGCTCGAGCAGGGACCTCGAGGAAAATGTTGTGGGAGTGTGTTTGTTGCTCAAGATGTGACGTGGCAAAGGATAGTGATGGACAAGTTCACTCGTCTTCAAGGTGATTACAGGGCCATAGTTCAAAATCCCAATCCTTTAATACCTC

Ace file of the UniGene sp_v3.0_unigene165050

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	Phytochrome N (Fragment) n=12 Tax=Pinaceae RepID=Q9FSD5_PINSY	-	-	1.0e-21	84%
FL-Next	sp=Phytochrome; Pinus sylvestris (Scots pine).	-	-	0.0	65%
Sma3	Phytochrome A	-	-	0.0	-

Source	Gene names
Sma3	ArPHYA16; ArPHYA23; At1g09570; At2g18790; F14J9.23; FHY2; FRE1; GSVIVT00003388001; GSVIVT00022486001; HY3; HY8; MA3; MSF3.17; OsI_010955; OsI_11260; OsJ_10581; PHY; PHY1; PHY2; PHY3; PHY4; PHY5c; PHYA; PHYB; PHYB1; PHYE; PHYP; PHYPADRAFT_115388; PHYPADRAF

Source	GOs	Term	Type	Identity
Sma3	cytoplasm	GO:0005737	Cellular Component	-
Sma3	membrane	GO:0016020	Cellular Component	-
Sma3	nuclear speck	GO:0016607	Cellular Component	-
Sma3	two-component sensor activity	GO:0000155	Molecular Function	-
Sma3	ATP binding	GO:0005524	Molecular Function	-
Sma3	G-protein coupled photoreceptor activity	GO:0008020	Molecular Function	-
Sma3	red or far-red light photoreceptor activity	GO:0009883	Molecular Function	-
Sma3	protein homodimerization activity	GO:0042803	Molecular Function	-
Sma3	two-component signal transduction system (phosphorelay)	GO:0000160	Biological Process	-
Sma3	regulation of transcription, DNA-dependent	GO:0006355	Biological Process	-
Sma3	signal transduction	GO:0007165	Biological Process	-
Sma3	sensory perception	GO:0007600	Biological Process	-
Sma3	response to cold	GO:0009409	Biological Process	-
Sma3	red, far-red light phototransduction	GO:0009585	Biological Process	-
Sma3	gravitropism	GO:0009630	Biological Process	-
Sma3	phototropism	GO:0009638	Biological Process	-
Sma3	entrainment of circadian clock	GO:0009649	Biological Process	-
Sma3	abscisic acid metabolic process	GO:0009687	Biological Process	-
Sma3	regulation of seed germination	GO:0010029	Biological Process	-
Sma3	red light signaling pathway	GO:0010161	Biological Process	-
Sma3	response to continuous far red light stimulus by the high-irradiance response system	GO:0010201	Biological Process	-
Sma3	response to low fluence red light stimulus	GO:0010202	Biological Process	-
Sma3	response to very low fluence red light stimulus	GO:0010203	Biological Process	-
Sma3	circadian regulation of calcium ion oscillation	GO:0010617	Biological Process	-
Sma3	protein-tetrapyrrole linkage	GO:0017006	Biological Process	-
Sma3	peptidyl-histidine phosphorylation	GO:0018106	Biological Process	-
Sma3	protein-chromophore linkage	GO:0018298	Biological Process	-
Sma3	response to arsenic-containing substance	GO:0046685	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	PAS	IPR000014	-	-
Sma3	PAS-associated, C-terminal	IPR000700	-	-
Sma3	Phytochrome	IPR001294	-	-
Sma3	PAC motif	IPR001610	-	-
Sma3	Phosphotransferase system, HPr serine phosphorylation site	IPR002114	-	-
Sma3	GAF domain	IPR003018	-	-
Sma3	ATPase-like, ATP-binding domain	IPR003594	-	-
Sma3	Signal transduction histidine kinase, subgroup 1, dimerisation/phosphoacceptor domain	IPR003661	-	-
Sma3	Signal transduction histidine kinase, core	IPR005467	-	-
Sma3	Phosphopantetheine attachment site	IPR006162	-	-
Sma3	Phytochrome A/B/C/D/E	IPR012129	-	-
Sma3	Phytochrome, central region	IPR013515	-	-
Sma3	Phytochrome chromophore binding site	IPR013516	-	-
Sma3	PAS fold-2	IPR013654	-	-
Sma3	PAS fold	IPR013767	-	-
Sma3	Phytochrome chromophore attachment domain	IPR016132	-	-
Sma3	Aldehyde dehydrogenase, conserved site	IPR016160	-	-
Sma3	WD40 repeat, conserved site	IPR019775	-	-
Sma3	Flagellar basal body rod protein, conserved site	IPR019776	-	-

Source	Species	ID	Description	e value	Identity
ATG	Arabidoptis thaliana	AT1G09570.1	PHYA, FHY2, FRE1, HY8 phytochrome A chr1:3095498-3099216 REVERSE LENGTH=1122	4.0e-19	71%
RefSeq	Arabidopsis thaliana	NP_172428.1	phytochrome A [Arabidopsis thaliana]	5.0e-19	71%
RefSeq	Populus trichocarpa	XP_002318913.1	phytochrome [Populus trichocarpa]	4.0e-20	71%

Full-Lengther Next Prediction

Fln status: Internal

Fln database: coniferopsida.fasta

Fln subject: Q41046

Fln msg: Overlapping hits, possible frame ERROR between 115 and 100, Distance to subject end: 363 aas, your sequence is shorter than subject: 71 - 1131

Fln protein: NSKLKTFGLQEEKGPVVLIVNACSSRDLEENVxxxxxxxQDVTWQRIVMDKFTRLQGDYRAIVQNPNPLIP

Protein Length: 72

Fln nts: AAATTCTAAACTCAAAACATTTGGCTTACAGGAGGAGAAGGGGCCTGTTGTTTTAATTGTTAATGCATGCTCGAGCAGGGACCTCGAGGAAAATGTTxxxxxxxxxxxxxxxxxxxxxCAAGATGTGACGTGGCAAAGGATAGTGATGGACAAGTTCACTCGTCTTCAAGGTGATTACAGGGCCATAGTTCAAAATCCCAATCCTTTAATACCTC

Fln Alignment:

HA8LWWM01A9H64___LKTFGLQEEKGPVVLIVNACSSRDLEENVVxxxxxAQDVTWQRIVMDKFTRLQGDYRAIVQNPNPLIP
Q41046________________LKTFGPQKEKEAVILVVNACSSRDFTDNIVxxxxxGQDVTSQKVVMDKFIRIQGDYRSIVQSPNPLIP

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain