UniGene Name: sp_v3.0_unigene165050
Length: 214 nt
![]() |
---|
>sp_v3.0_unigene165050
A |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Phytochrome N (Fragment) n=12 Tax=Pinaceae RepID=Q9FSD5_PINSY | - | - | 1.0e-21 | 84% |
FL-Next | sp=Phytochrome; Pinus sylvestris (Scots pine). | - | - | 0.0 | 65% |
Sma3 | Phytochrome A | - | - | 0.0 | - |
Source | Gene names |
---|---|
Sma3 | ArPHYA16; ArPHYA23; At1g09570; At2g18790; F14J9.23; FHY2; FRE1; GSVIVT00003388001; GSVIVT00022486001; HY3; HY8; MA3; MSF3.17; OsI_010955; OsI_11260; OsJ_10581; PHY; PHY1; PHY2; PHY3; PHY4; PHY5c; PHYA; PHYB; PHYB1; PHYE; PHYP; PHYPADRAFT_115388; PHYPADRAF |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
Sma3 | nuclear speck | GO:0016607 | Cellular Component | 0.0 | - |
Sma3 | two-component sensor activity | GO:0000155 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | G-protein coupled photoreceptor activity | GO:0008020 | Molecular Function | 0.0 | - |
Sma3 | red or far-red light photoreceptor activity | GO:0009883 | Molecular Function | 0.0 | - |
Sma3 | protein homodimerization activity | GO:0042803 | Molecular Function | 0.0 | - |
Sma3 | two-component signal transduction system (phosphorelay) | GO:0000160 | Biological Process | 0.0 | - |
Sma3 | regulation of transcription, DNA-dependent | GO:0006355 | Biological Process | 0.0 | - |
Sma3 | signal transduction | GO:0007165 | Biological Process | 0.0 | - |
Sma3 | sensory perception | GO:0007600 | Biological Process | 0.0 | - |
Sma3 | response to cold | GO:0009409 | Biological Process | 0.0 | - |
Sma3 | red, far-red light phototransduction | GO:0009585 | Biological Process | 0.0 | - |
Sma3 | gravitropism | GO:0009630 | Biological Process | 0.0 | - |
Sma3 | phototropism | GO:0009638 | Biological Process | 0.0 | - |
Sma3 | entrainment of circadian clock | GO:0009649 | Biological Process | 0.0 | - |
Sma3 | abscisic acid metabolic process | GO:0009687 | Biological Process | 0.0 | - |
Sma3 | regulation of seed germination | GO:0010029 | Biological Process | 0.0 | - |
Sma3 | red light signaling pathway | GO:0010161 | Biological Process | 0.0 | - |
Sma3 | response to continuous far red light stimulus by the high-irradiance response system | GO:0010201 | Biological Process | 0.0 | - |
Sma3 | response to low fluence red light stimulus | GO:0010202 | Biological Process | 0.0 | - |
Sma3 | response to very low fluence red light stimulus | GO:0010203 | Biological Process | 0.0 | - |
Sma3 | circadian regulation of calcium ion oscillation | GO:0010617 | Biological Process | 0.0 | - |
Sma3 | protein-tetrapyrrole linkage | GO:0017006 | Biological Process | 0.0 | - |
Sma3 | peptidyl-histidine phosphorylation | GO:0018106 | Biological Process | 0.0 | - |
Sma3 | protein-chromophore linkage | GO:0018298 | Biological Process | 0.0 | - |
Sma3 | response to arsenic-containing substance | GO:0046685 | Biological Process | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G09570.1 | PHYA, FHY2, FRE1, HY8 phytochrome A chr1:3095498-3099216 REVERSE LENGTH=1122 | 4.0e-19 | 71% |
RefSeq | Arabidopsis thaliana | NP_172428.1 | phytochrome A [Arabidopsis thaliana] | 5.0e-19 | 71% |
RefSeq | Populus trichocarpa | XP_002318913.1 | phytochrome [Populus trichocarpa] | 4.0e-20 | 71% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: Q41046
Fln msg: Overlapping hits, possible frame ERROR between 115 and 100, Distance to subject end: 363 aas, your sequence is shorter than subject: 71 - 1131
Fln protein:
N
Protein Length:
72
Fln nts:
A
Fln Alignment:
HA8LWWM01A9H64___LKTFGLQEEKGPVVLIVNACSSRDLEENVVxxxxxAQDVTWQRIVMDKFTRLQGDYRAIVQNPNPLIP
Q41046________________LKTFGPQKEKEAVILVVNACSSRDFTDNIVxxxxxGQDVTSQKVVMDKFIRIQGDYRSIVQSPNPLIP
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain