UniGene Name: sp_v3.0_unigene165049
Length: 194 nt
![]() |
---|
>sp_v3.0_unigene165049
T |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | S-receptor kinase 1 (Fragment) n=1 Tax=Selaginella moellendorffii RepID=D8R4F7_SELML | - | - | 9.0e-16 | 56% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 59% |
Sma3 | Kinase R-like protein | - | - | 9.585e-06 | - |
Source | Gene names |
---|---|
Sma3 | AT4g32300; At1g34300; At4g32300; B1423D04.25; F10M6.60; F23M19.5; F8B4.10; GSVIVT00000338001; GSVIVT00001733001; GSVIVT00001735001; GSVIVT00016916001; GSVIVT00032659001; GSVIVT00034874001; GSVIVT00034886001; GSVIVT00037801001; LOC_Os03g62180; OSIGBa0145C1 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | protein kinase activity | GO:0004672 | Molecular Function | 0.0 | - |
Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
Sma3 | receptor activity | GO:0004872 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | sugar binding | GO:0005529 | Molecular Function | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Sma3 | recognition of pollen | GO:0048544 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
Sma3 | Epidermal growth factor-like domain | IPR000742 | - | 0.0 | - |
Sma3 | S-locus glycoprotein | IPR000858 | - | 0.0 | - |
Sma3 | Bulb-type lectin domain | IPR001480 | - | 0.0 | - |
Sma3 | Apple-like | IPR003609 | - | 0.0 | - |
Sma3 | Epidermal growth factor-like | IPR006210 | - | 0.0 | - |
Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
Sma3 | PAN-2 domain | IPR013227 | - | 0.0 | - |
Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
Sma3 | IPR017442 | - | 0.0 | - | |
Sma3 | Peptidase S26A, signal peptidase I, serine active site | IPR019756 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G34300.1 | lectin protein kinase family protein chr1:12503450-12505939 FORWARD LENGTH=829 | 9.0e-21 | 61% |
RefSeq | Arabidopsis thaliana | NP_174690.1 | lectin protein kinase-like protein [Arabidopsis thaliana] | 1.0e-20 | 61% |
RefSeq | Populus trichocarpa | XP_002317112.1 | predicted protein [Populus trichocarpa] | 1.0e-20 | 53% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NM60
Fln msg: Distance to subject end: 242 aas, your sequence is shorter than subject: 64 - 431
Fln protein:
F
Protein Length:
65
Fln nts:
T
Fln Alignment:
HA8LWWM01BXD0J___FGTVYEGVLEDGTMVAVKRL-EIARQGEKEFYSEIAILGSIHHWNLVQLLGFCSQGSHKILIYE
A9NM60________________FGTVYEGILEDDTLVAVKCLVNESRQGQAEFCAEIGTTSSINHSNLVRLHGICVEGQHRILVYE
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain