SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene165006

Length: 255 nt

UniGene Fasta

>sp_v3.0_unigene165006
AAAAATCGCCGTTTCATGATTTATGTCCATTCAAAGGGTATGATTGTAGACGATGAGTACATCATTCTAGGGTCATCAAATATTAACCAACGTTCAATGGATGGTTCAAGAGACACTGAGATTGCTATGGGTGCATATCAACCACAATATACGTGGTCTAAAAAGCGAGACCATCCACATGGCCAGGTATATGGGTATAGAATGGCTCTCTGGGACAGAGCATCTTGCAGTTGTTGAGGATTGCTTTCAGCATCC

Ace file of the UniGene sp_v3.0_unigene165006

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	Phospholipase D (Fragment) n=1 Tax=Vitis vinifera RepID=D7TGZ9_VITVI	-	-	2.0e-30	83%
FL-Next	sp=Phospholipase D; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	0.0	78%
Sma3	Phospholipase D	-	-	2.694e-33	-

Source	ECs	Term	Type	e value	Identity
Sma3	Phospholipase D.	EC:3.1.4.4	-	0.0	-

Source	KEGGs	Term	Identity
Sma3	Glycerophospholipid metabolism	00564	%
Sma3	Ether lipid metabolism	00565	%
Sma3	Metabolic pathways	01100	%

Source	Gene names
Sma3	A_IG005I10.13; At1g52570; At1g55180; At2g42010; At3g15730; At4g00240; At4g11830; At4g11840; At4g11850; At4g35790; At5g25370; F18G18.110; F4B14.60; F5I10.13; F6D8.21; F7A10.25; GSVIVT00000347001; GSVIVT00001073001; GSVIVT00012363001; GSVIVT00015517001; GSV

Source	GOs	Term	Type	Identity
Sma3	nucleus	GO:0005634	Cellular Component	-
Sma3	cytoplasm	GO:0005737	Cellular Component	-
Sma3	mitochondrion	GO:0005739	Cellular Component	-
Sma3	vacuole	GO:0005773	Cellular Component	-
Sma3	endoplasmic reticulum	GO:0005783	Cellular Component	-
Sma3	plasma membrane	GO:0005886	Cellular Component	-
Sma3	chloroplast	GO:0009507	Cellular Component	-
Sma3	plastid	GO:0009536	Cellular Component	-
Sma3	chloroplast envelope	GO:0009941	Cellular Component	-
Sma3	membrane	GO:0016020	Cellular Component	-
Sma3	cytosolic ribosome	GO:0022626	Cellular Component	-
Sma3	clathrin-coated vesicle	GO:0030136	Cellular Component	-
Sma3	cytoplasmic vesicle	GO:0031410	Cellular Component	-
Sma3	catalytic activity	GO:0003824	Molecular Function	-
Sma3	phospholipase D activity	GO:0004630	Molecular Function	-
Sma3	calcium ion binding	GO:0005509	Molecular Function	-
Sma3	protein binding	GO:0005515	Molecular Function	-
Sma3	NAPE-specific phospholipase D activity	GO:0070290	Molecular Function	-
Sma3	fatty acid metabolic process	GO:0006631	Biological Process	-
Sma3	metabolic process	GO:0008152	Biological Process	-
Sma3	phospholipid catabolic process	GO:0009395	Biological Process	-
Sma3	response to cold	GO:0009409	Biological Process	-
Sma3	response to water deprivation	GO:0009414	Biological Process	-
Sma3	response to salt stress	GO:0009651	Biological Process	-
Sma3	response to abscisic acid stimulus	GO:0009737	Biological Process	-
Sma3	abscisic acid mediated signaling pathway	GO:0009738	Biological Process	-
Sma3	positive regulation of abscisic acid mediated signaling pathway	GO:0009789	Biological Process	-
Sma3	embryo development ending in seed dormancy	GO:0009793	Biological Process	-
Sma3	defense response to bacterium, incompatible interaction	GO:0009816	Biological Process	-
Sma3	seed germination	GO:0009845	Biological Process	-
Sma3	ethylene mediated signaling pathway	GO:0009873	Biological Process	-
Sma3	regulation of stomatal movement	GO:0010119	Biological Process	-
Sma3	programmed cell death	GO:0012501	Biological Process	-
Sma3	lipid catabolic process	GO:0016042	Biological Process	-
Sma3	membrane lipid catabolic process	GO:0046466	Biological Process	-
Sma3	phosphatidylcholine metabolic process	GO:0046470	Biological Process	-
Sma3	phosphatidic acid metabolic process	GO:0046473	Biological Process	-
Sma3	response to cadmium ion	GO:0046686	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	C2 calcium-dependent membrane targeting	IPR000008	-	-
Sma3	Peptidase, cysteine peptidase active site	IPR000169	-	-
Sma3	Phospholipase D/Transphosphatidylase	IPR001736	-	-
Sma3	YLP motif	IPR004019	-	-
Sma3	Adenosine/AMP deaminase active site	IPR006650	-	-
Sma3	Phospholipase D, plant	IPR011402	-	-
Sma3	Phospholipase D	IPR015679	-	-
Sma3	C2 membrane targeting protein	IPR018029	-	-

Source	Species	ID	Description	e value	Identity
ATG	Arabidoptis thaliana	AT2G42010.1	PLDBETA1, PLDBETA phospholipase D beta 1 chr2:17533018-17537990 REVERSE LENGTH=1083	3.0e-35	74%
RefSeq	Arabidopsis thaliana	NP_565963.2	phospholipase D [Arabidopsis thaliana]	4.0e-35	74%
RefSeq	Populus trichocarpa	XP_002304050.1	predicted protein [Populus trichocarpa]	1.0e-37	81%

Full-Lengther Next Prediction

Fln status: Internal

Fln database: coniferopsida.fasta

Fln subject: B8LQ49

Fln msg: Unexpected STOP codon at 3' end. Distance to subject end: 74 aas, your sequence is shorter than subject: 79 - 861

Fln protein: KNRRFMIYVHSKGMIVDDEYIILGSSNINQRSMDGSRDTEIAMGAYQPQYTWSKKRDHPHGQVYGYRMALWDRASCSC*

Protein Length: 80

Fln nts: AAAAATCGCCGTTTCATGATTTATGTCCATTCAAAGGGTATGATTGTAGACGATGAGTACATCATTCTAGGGTCATCAAATATTAACCAACGTTCAATGGATGGTTCAAGAGACACTGAGATTGCTATGGGTGCATATCAACCACAATATACGTGGTCTAAAAAGCGAGACCATCCACATGGCCAGGTATATGGGTATAGAATGGCTCTCTGGGACAGAGCATCTTGCAGTTGTTGAGGATTGCTTTCAGCATCC

Fln Alignment:

HA8LWWM01A1TI3___KNRRFMIYVHSKGMIVDDEYIILGSSNINQRSMDGSRDTEIAMGAYQPQYTWSKKRDHPHGQVYGYRMALW
B8LQ49________________KFRRFMIYVHAKGMIVDDEYVIMGSANINERSLDGSRDTEIAMGSYQPHHTWDRKQRHPHGQVYGYRMSLW

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain