UniGene Name: sp_v3.0_unigene165001
Length: 240 nt
![]() |
---|
>sp_v3.0_unigene165001
G |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Putative receptor-like protein kinase 2 (Fragment) n=1 Tax=Musa acuminata RepID=Q64GB6_MUSAC | - | - | 9.0e-24 | 65% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 51% |
Sma3 | S-domain receptor-like protein kinase | - | - | 1.319e-11 | - |
Source | Gene names |
---|---|
Sma3 | 17L07.5; AT4g32300; At1g34300; At2g19130; At4g32300; B1099D03.46; B1099D03.51; B1423D04.25; DUPR11.18; F10M6.60; F23M19.5; F8B4.10; GSVIVT00000338001; GSVIVT00001733001; GSVIVT00001735001; GSVIVT00014890001; GSVIVT00014893001; GSVIVT00014894001; GSVIVT000 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | cell surface | GO:0009986 | Cellular Component | 0.0 | - |
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
Sma3 | receptor activity | GO:0004872 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | sugar binding | GO:0005529 | Molecular Function | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Sma3 | recognition of pollen | GO:0048544 | Biological Process | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G34300.1 | lectin protein kinase family protein chr1:12503450-12505939 FORWARD LENGTH=829 | 8.0e-25 | 61% |
RefSeq | Arabidopsis thaliana | NP_174690.1 | lectin protein kinase-like protein [Arabidopsis thaliana] | 1.0e-24 | 61% |
RefSeq | Populus trichocarpa | XP_002322923.1 | predicted protein [Populus trichocarpa] | 2.0e-29 | 73% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NM60
Fln msg: Distance to subject end: 224 aas, your sequence is shorter than subject: 79 - 431
Fln protein:
V
Protein Length:
80
Fln nts:
G
Fln Alignment:
HA8LWWM01CIQK2___VYKGVLTDGEVVAVKRLEGVS-QGHDQFWAEVSVIGRVHHMNLVRMFGFCAEGNHRLLVYEYIENGSLDKYL
A9NM60________________VYEGILEDDTLVAVKCLVNESRQGQAEFCAEIGTTSSINHSNLVRLHGICVEGQHRILVYEFMANGSLDRWL
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain