UniGene Name: sp_v3.0_unigene164988
Length: 177 nt
![]() |
---|
>sp_v3.0_unigene164988
A |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | RAN [Nicotiana sylvestris] gb|AAT40987.1| RAN [Nicotiana sylvestris] | - | - | 1.0e-17 | 91% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 100% |
Sma3 | Ras-related nuclear protein 3 | - | - | 5.848e-08 | - |
Source | Gene names |
---|---|
Sma3 | At5g20010; At5g20020; At5g55080; At5g55190; CHLREDRAFT_128522; F28I16.160; F28I16.170; GSVIVT00016839001; GSVIVT00032600001; GSVIVT00032601001; GSVIVT00034551001; MCO15.14; MCO15.3; MICPUCDRAFT_33456; MICPUN_82870; OSTLU_41856; OsI_022799; OsJ_19635; OsJ_ |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | cell wall | GO:0005618 | Cellular Component | 0.0 | - |
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | nuclear envelope | GO:0005635 | Cellular Component | 0.0 | - |
Sma3 | nucleolus | GO:0005730 | Cellular Component | 0.0 | - |
Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
Sma3 | ribosome | GO:0005840 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | apoplast | GO:0048046 | Cellular Component | 0.0 | - |
Sma3 | GTPase activity | GO:0003924 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | GTP binding | GO:0005525 | Molecular Function | 0.0 | - |
Sma3 | intracellular protein transport | GO:0006886 | Biological Process | 0.0 | - |
Sma3 | nucleocytoplasmic transport | GO:0006913 | Biological Process | 0.0 | - |
Sma3 | signal transduction | GO:0007165 | Biological Process | 0.0 | - |
Sma3 | small GTPase mediated signal transduction | GO:0007264 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Small GTPase superfamily | IPR001806 | - | 0.0 | - |
Sma3 | Ran GTPase | IPR002041 | - | 0.0 | - |
Sma3 | RNA polymerase sigma factor 54, interaction | IPR002078 | - | 0.0 | - |
Sma3 | Small GTP-binding protein domain | IPR005225 | - | 0.0 | - |
Sma3 | IPR013753 | - | 0.0 | - | |
Sma3 | IPR018210 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT5G20010.1 | RAN-1, RAN1, ATRAN1 RAS-related nuclear protein-1 chr5:6760364-6761747 FORWARD LENGTH=221 | 3.0e-24 | 91% |
RefSeq | Arabidopsis thaliana | NP_200330.1 | GTP-binding nuclear protein Ran-3 [Arabidopsis thaliana] | 4.0e-24 | 91% |
RefSeq | Populus trichocarpa | XP_002324846.1 | predicted protein [Populus trichocarpa] | 4.0e-24 | 91% |
![]() |
---|
Fln status: N-terminus
Fln database: coniferopsida.fasta
Fln subject: A9NLB5
Fln msg: Distance to subject end: 169 aas, your sequence is shorter than subject: 53 - 224
Fln protein:
M
Protein Length:
54
Fln nts:
A
Fln Alignment:
HA8LWWM01B39KO___ANVNCPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHP
A9NLB5________________ANVNCPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHP
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain