UniGene Name: sp_v3.0_unigene164962
Length: 191 nt
UniGene Fasta
|
|---|
| >sp_v3.0_unigene164962
A |
Ace file of the UniGene sp_v3.0_unigene164962
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | CLL1B clavata1-like receptor S/T protein kinase protein n=1 Tax=Physcomitrella patens subsp. patens RepID=A9RER6_PHYPA | - | - | 4.0e-13 | 73% |
| FL-Next | tr=Clavata-like receptor; Picea glauca (White spruce) (Pinus glauca). | - | - | 0.0 | 69% |
| Sma3 | Receptor protein kinase CLAVATA1, putative | - | - | 8.387e-19 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | 2-alkenal reductase. | EC:1.3.1.74 | - | 2.209e-11 | - |
| Sma3 | Mitogen-activated protein kinase kinase kinase. | EC:2.7.11.25 | - | 1.901e-08 | - |
| Source | Gene names |
|---|---|
| Sma3 | AT1G28440; AT1G75820; AT2G33170; AT3G49670; AT4G28490; AT4G28650; AT5G65700; AT5G65710; At1g09970; At1g17230; At1g28440; At1g75820; At2g33170; At3g19700; At3g49670; At4g28490; At4g28650; At5g65700; CLAVATA1; CLL1A; CLL1B; CLL2; CLV; CLV1; CLV1A; CLV1B; CM |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
| Sma3 | aminopeptidase activity | GO:0004177 | Molecular Function | 0.0 | - |
| Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
| Sma3 | receptor activity | GO:0004872 | Molecular Function | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | identical protein binding | GO:0042802 | Molecular Function | 0.0 | - |
| Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
| Sma3 | proteolysis | GO:0006508 | Biological Process | 0.0 | - |
| Sma3 | regulation of meristem structural organization | GO:0009934 | Biological Process | 0.0 | - |
| Sma3 | endosperm development | GO:0009960 | Biological Process | 0.0 | - |
| Sma3 | regulation of meristem growth | GO:0010075 | Biological Process | 0.0 | - |
| Sma3 | microsporocyte differentiation | GO:0010480 | Biological Process | 0.0 | - |
| Sma3 | cell differentiation | GO:0030154 | Biological Process | 0.0 | - |
| Sma3 | protein autophosphorylation | GO:0046777 | Biological Process | 0.0 | - |
| Sma3 | gametophyte development | GO:0048229 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Alpha/beta hydrolase fold-1 | IPR000073 | - | 0.0 | - |
| Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
| Sma3 | Leucine-rich repeat | IPR001611 | - | 0.0 | - |
| Sma3 | Enolpyruvate transferase domain | IPR001986 | - | 0.0 | - |
| Sma3 | Peptidase S33 | IPR002410 | - | 0.0 | - |
| Sma3 | Aminotransferases, class-I, pyridoxal-phosphate-binding site | IPR004838 | - | 0.0 | - |
| Sma3 | Retrotransposon gag protein | IPR005162 | - | 0.0 | - |
| Sma3 | Proline iminopeptidase | IPR005944 | - | 0.0 | - |
| Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
| Sma3 | Leucine-rich repeat-containing N-terminal, type 2 | IPR013210 | - | 0.0 | - |
| Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
| Sma3 | IPR017442 | - | 0.0 | - | |
| Sma3 | HTH domain AraC-type, conserved site | IPR018062 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT1G75820.1 | CLV1, FAS3, FLO5, ATCLV1 Leucine-rich receptor-like protein kinase family protein chr1:28463631-28466652 REVERSE LENGTH=980 | 2.0e-15 | 74% |
| RefSeq | Arabidopsis thaliana | NP_177710.1 | receptor protein kinase CLAVATA1 [Arabidopsis thaliana] | 3.0e-15 | 74% |
| RefSeq | Populus trichocarpa | XP_002303493.1 | predicted protein [Populus trichocarpa] | 6.0e-16 | 67% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: Q19AV8
Fln msg: Distance to subject end: 80 aas, your sequence is shorter than subject: 63 - 998
Fln protein:
N
Protein Length:
64
Fln nts:
A
Fln Alignment:
HA8LWWM01EYG4P___EYAYTLKVNEKSDIYSFGVVLLELVTGKKLNDVEFGDDLSIVRWVRNQI
Q19AV8________________EYAYTLKVNEKSDIYSFGVVILELVTGRRPVDPEFGENKDLVKWLCNKI

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta